SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020149937.1.58150 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020149937.1.58150
Domain Number 1 Region: 133-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-22
Family B3 DNA binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020149937.1.58150
Sequence length 241
Comment B3 domain-containing protein Os03g0184500-like [Aegilops tauschii subsp. tauschii]; AA=GCF_001957025.1; RF=representative genome; TAX=169297; STAX=37682; NAME=Aegilops tauschii subsp. tauschii; cultivar=AL8/78; AL=Contig; RT=Major
Sequence
MAIEKKGMSAYEAERERTVEENKRKMEALNLRHLSAAVAPKTPSPMKHKRRRIIEAATPV
PSPPRRSRRLAHIPEVKYADACAEVGEDSERVGRWSPRRRSGSIYLAGGGGGPISMKARM
EAASKAEELESQLDPEFPSFMKRMLHSHVVRGFWLGLPSHFCDTYLPKNDCTITLVDEKD
EEFESKYLAYKKGLSGGWAGFALDHVIRDGDSTVFQLIKPTTFKVHIIRAAVGDDNNEEM
E
Download sequence
Identical sequences N1QUR2
EMT12994 XP_020149937.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]