SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020175391.1.58150 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020175391.1.58150
Domain Number 1 Region: 183-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-17
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020175391.1.58150
Sequence length 302
Comment B3 domain-containing protein Os06g0112300-like [Aegilops tauschii subsp. tauschii]; AA=GCF_001957025.1; RF=representative genome; TAX=169297; STAX=37682; NAME=Aegilops tauschii subsp. tauschii; cultivar=AL8/78; AL=Contig; RT=Major
Sequence
MAAASTEPALPGGSPADEDAEAVVASDELRHLPDQALQARLQRMQASIHGGIAARLPDGG
RTYRRKLLAVRRELERRKGQAPALPATAPHSPSPLPSSQHPPPCQGGPPDDVGCKHIVES
SDVQGTSSLPDQVKDEQMETPVCPSKQLPDAHIIKPKVEPCDDTLSPAPDASEDCETTPL
SCSHPFFTIILSRSHVQKPFQLYIPGRFHKHLPEERTSATLICRGRSWAMRYCGDLKTKR
LDADWMDFAVDNRLQVNDACVFELVTGTREEVVFQVQILRGGLPKDITSKGYTADEPLVI
VG
Download sequence
Identical sequences R7W235
EMT13166 XP_020175391.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]