SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020181683.1.58150 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020181683.1.58150
Domain Number 1 Region: 286-433
Classification Level Classification E-value
Superfamily EF-hand 4.33e-44
Family Calmodulin-like 0.0000726
Further Details:      
 
Domain Number 2 Region: 95-261
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.76e-21
Family PsbP-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020181683.1.58150
Sequence length 440
Comment psbP domain-containing protein 5, chloroplastic-like [Aegilops tauschii subsp. tauschii]; AA=GCF_001957025.1; RF=representative genome; TAX=169297; STAX=37682; NAME=Aegilops tauschii subsp. tauschii; cultivar=AL8/78; AL=Contig; RT=Major
Sequence
MAAALLSPASPLPRSSSAAHPRSKGAAGAAWCAPPSRRRAVSCSCAPDSWSRGLERRQLV
LSGLACSFAIVLPISVVESCAAAAEVDDDGVKMAMLVDETNAYSFLYPVQLPGKKTSFRW
VESRKSERYSSAAPLSPDARQRIVSERLDMINNAVISVSIGPPSSRFLPSKDKKTWAAKD
VADCVLSDKSSLKVTTSQRMAESSVLDAHTTDVDGEPYWYYEYIVRKSPTKSDGFVHSPF
FSLGFLYSLNASTLSKQWESTSYFRGQRQEPSSDDPRPGYRRDRGGRKRLTAQKRKEIKE
AFDLFDTDGSGTIDARELNVAMRALGFEMTPEQIQQMIAEVDKDGSGTIDLDEFIHMMTD
KMGERDARDELHKAFRIIDQDANGKISDMDIQRLAIEAGEHFTLDEVREMIQAADENGDG
EVDMEEFMKMMKRTGFGAGF
Download sequence
Identical sequences XP_020181683.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]