SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020192155.1.58150 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020192155.1.58150
Domain Number 1 Region: 115-209
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-16
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020192155.1.58150
Sequence length 217
Comment B3 domain-containing protein Os06g0194400-like [Aegilops tauschii subsp. tauschii]; AA=GCF_001957025.1; RF=representative genome; TAX=169297; STAX=37682; NAME=Aegilops tauschii subsp. tauschii; cultivar=AL8/78; AL=Contig; RT=Major
Sequence
MAEPNSCEEQCRRQVEENKRKLEELRLHRLSVAVREAAVKPKPTKLPRRCRDAPTRLSGR
VAGLPEQPDYRDRKIRGGAYVDRRQLPPDDVYATDEASAYALTKAEELKSQLCFDHPSFV
KPICYKTATASCLRIPQLFKEWYLPWCNEMIYLVDEQDVEFHLPYYALSGSIGTGWKMFA
ISHNLADGDCLVFQQVQKTKFKVYIIRASSYYEKDHC
Download sequence
Identical sequences M8BMF0
XP_020192155.1.58150 EMT26160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]