SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020304113.1.37734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020304113.1.37734
Domain Number 1 Region: 245-410,440-490
Classification Level Classification E-value
Superfamily TPR-like 2.28e-28
Family Tetratricopeptide repeat (TPR) 0.0038
Further Details:      
 
Weak hits

Sequence:  XP_020304113.1.37734
Domain Number - Region: 88-133
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0222
Family N-terminal coiled coil domain from apc 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020304113.1.37734
Sequence length 553
Comment kinesin light chain protein 2 [Loa loa]; AA=GCF_000183805.2; RF=representative genome; TAX=7209; STAX=7209; NAME=Loa loa; AL=Scaffold; RT=Major
Sequence
MTALSQEEILQSTRTVVQGLEALKDEHESIKGTLVNSIQGLNADESALIEEKTHIVDRNL
EMLRLGIEEAQVMMALAGHLQTVEAEKQKLKAQVRRLCQENAWLRDELNSTQQKLQATGQ
QVAQLEEEKKHLEYMNSIKKYDDQQENDKTMDQSDNRSDNTLQDLGFGPEEDEEISGHMT
GQFAHPTPAHSMAASASAGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTS
GHDHPDVATMLNILALVYRDQNKYKEAANLLNEALHIREKCLGESHPAVAATLNNLAVLY
GKRGKYKDAEPLCKRALEIRENVLGADHPDVAKQLNNLALLCQNQGKYDEVERYYKRALE
IYEAKLGPDDPNVAKTKNNLSSAYLKQGKYKDAEILYKQILTRAHEREFGKVADDNKPIW
QIAEDREENKHKGGGDTSTYQEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGKYEAAETL
EDAALRAKKQHEPPVSGHQSALTATSTYADDSLMSSVVASQASRGMTQSQSSSGLKSRLF
NALGLQQQQQQLP
Download sequence
Identical sequences A0A1S0UBJ9
XP_020304113.1.37734 LOAG_00420T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]