SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020378711.1.65276 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020378711.1.65276
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-55
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 2 Region: 180-418
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-51
Family YWTD domain 0.00000383
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-40
Family YWTD domain 0.0000514
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-27
Family YWTD domain 0.0000548
Further Details:      
 
Domain Number 5 Region: 1095-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 6 Region: 738-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 8 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000301
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000559
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 11 Region: 1054-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000355
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020378711.1.65276
Sequence length 1458
Comment low-density lipoprotein receptor-related protein 6 [Rhincodon typus]; AA=GCF_001642345.1; RF=representative genome; TAX=259920; STAX=259920; NAME=Rhincodon typus; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGTTRSIIIDSNIYWPNGLTLDYEEEKLYWADAKLSFIHRSNF
DGSLRQVVVEGSLPHPFALTLFGDTLYWTDWNTHSIHACNKYTGDYRREVHRNIFSPMDI
HVFNQQRQPNATNPCGSNNGGCSHLCLMSPIKPFFQCACPTGVQLLEDGTMCKDGASELL
LLARRTDLRRISLDTPDFTDVILQLDDIRHAIAIDYDPVEGYIYWTDDEVRAIRRAYLDG
SGSQFVVTSQINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAI
VLDPMSGHMYWTDWGEIPKIERAALDGSDRVILVNTSLGWPNGLALDYKERKMYWGDAKT
DKIEVMNCDGTGRRVLVEDKLPHIFGFTLLGNYVYWTDWQRRSIERVDKRSAEREIIIDQ
LPDLMGLKATNVHQILGTNPCAEDNGGCSHLCLYRPQGVRCACPIGLELIRDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSSLEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVARLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGTGRITLVPNVGRANGLTIDYAERRLYWTDLD
TSLIESSNMLGLDREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQGGWNECASSNGHCSHLCLAMPTVGYVCGCPAHYYLNMDNKTCSP
PTSFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPVDKHLYWIDSRQNVIRR
AQEDGTQSFTVVTSAIPNQNLDMQPYDLSIDIYSRYIFWTCEATNVINVTRLDGKAIGVV
LRGEQDRPRAIIVNPERGYMYFTNLQDRSPRIERAALDGTEREVLFLSGLSKPVALAIDN
KLGKLFWADSDLRRIESSDLSGANRIVLEDANILQPVGLTIFGNHLYWIDRQQQMLERIE
KTNGYGRTKIQARIAQLSDIHAVKELDLKEFAEHPCAQDNGGCSHICIVKGDGTTRCSCP
VHLVLLQDELSCGEPPTCAPDHFTCATGEIDCIPLAWRCDGYPECDDQSDEQNCPVCSDS
QFQCASGQCIDAVFRCNGETNCQDQSDEQKCEVLCAMDQFQCATGQCIAKHKRCDHNGDC
TDNSDEHACYPTEEPTPQPTSTIGSIIGVILSVFVIGAIYFICQRVLCPRMKGDGETMTN
DFVVHGSASVPLGYVPHTNSLPGSLQGMSRGKPVMSSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPPMLNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYAYRNFAPPTTP
CSTDVCDSDYTPGRRIATTKCYGDLNYDSEPFPPPPTPRSQYLSAEENYESCPPSPYTER
SYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_020378711.1.65276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]