SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020402857.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020402857.1.34533
Domain Number 1 Region: 22-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-22
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 229-330
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.75e-17
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020402857.1.34533
Sequence length 337
Comment putative B3 domain-containing protein Os03g0621600 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MRKPSNGCKERDVIYHRNDHTDDNGKHFFKILIGDFHKRLVIPVKFAKKFRGKVERNIKL
ESLGGYTFDVQVAQNLGRIMFQSGWKSFVSAHDLKMFDLLVFKYDGMSRMKVLIFDPSGC
EKVPPFFVTKNAMSGGRKREEPQEPLDISSSYADLPMKTPETKKKARKQRDRSRINISPC
RSISNSSGGMRSSEDDEAHSVPSCILPRGTILDSMQRRKVKERLRAICSEIPIYVFVVKK
SNIFGRSQDMVFSRKYPDVCLPFKSGAVILQCHGKSWEVILEVRKDQGESKRLRIGWAEF
ARDNNLQLGDICLFEPLKTMKYTMNVHIVRRRVRSGK
Download sequence
Identical sequences GRMZM2G088427_T01|PACid:20870033 GRMZM2G088427_P01 XP_008665125.1.34533 XP_020402857.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]