SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020448834.1.23826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020448834.1.23826
Domain Number 1 Region: 5-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-56
Family G proteins 0.0000000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020448834.1.23826
Sequence length 207
Comment ras-related protein rab7 [Monopterus albus]; AA=GCF_001952655.1; RF=representative genome; TAX=43700; STAX=43700; NAME=Monopterus albus; AL=Scaffold; RT=Major
Sequence
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDRNERAKPSAETCSC
Download sequence
Identical sequences A0A0F8BIH8 E6ZFW1 G3P576 H2UEY9 H3D0L3 H9BW96 I3KWY1 W8PGB8
ENSGMOP00000012087 ENSONIP00000025627 ENSGACP00000012749 31033.ENSTRUP00000035508 69293.ENSGACP00000012749 99883.ENSTNIP00000014049 ENSTNIP00000014049 ENSGMOP00000012087 ENSTRUP00000035508 ENSTNIP00000014049 ENSONIP00000025627 XP_003442718.1.78416 XP_003973592.1.43653 XP_004545390.1.88231 XP_005746511.1.53837 XP_005915437.1.24487 XP_006784699.1.46954 XP_008283660.1.38333 XP_010777721.1.77114 XP_010777722.1.77114 XP_012696615.1.3086 XP_012717637.1.37407 XP_012717638.1.37407 XP_012717639.1.37407 XP_017566840.1.86671 XP_017566849.1.86671 XP_019111375.1.61708 XP_019736121.1.30352 XP_019942298.1.63745 XP_020448833.1.23826 XP_020448834.1.23826 XP_020485012.1.8198 XP_022055912.1.10920 ENSTRUP00000035508 ENSGACP00000012749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]