SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020469095.1.23826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020469095.1.23826
Domain Number 1 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-54
Family YWTD domain 0.00000209
Further Details:      
 
Domain Number 2 Region: 332-570
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-52
Family YWTD domain 0.00000372
Further Details:      
 
Domain Number 3 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-49
Family YWTD domain 0.00000752
Further Details:      
 
Domain Number 4 Region: 955-1198
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-38
Family YWTD domain 0.0000533
Further Details:      
 
Domain Number 5 Region: 1327-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1248-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 7 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 8 Region: 891-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000296
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 286-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 10 Region: 589-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000387
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1206-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000137
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020469095.1.23826
Sequence length 1571
Comment LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 6 [Monopterus albus]; AA=GCF_001952655.1; RF=representative genome; TAX=43700; STAX=43700; NAME=Monopterus albus; AL=Scaffold; RT=Major
Sequence
MGVLLRCLLLCSFCLLVRAVPLLLYANRRDLRLVDAAHEKANATVVVGGLEDAAAVDYVY
SQGLIYWSDVSEEAIKRTVFNQSGASAVQTVLPGLASPDGLACDWLGSKLYWTDSETNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGYMYWTDWGEIPKIERAGMDGTNRSMIIDK
DIYWPNGLTLDYSLQKLYWADAKHNFIHRSNLDGSSREVVVKEGLPHPFALTLYEDTLFW
TDWNTHSIHSCRKQTGAEQRVVHSDIFSPMDIHVFSPKRQPALSSPCSLKNGGCSHLCLL
SPTKPYYQCACPTGVQLLEDGKTCRDGAAQMLLLARRTDLRRISLDMPDFTDIILQVDDI
RHAIAIDFDPVEGYIYWTDDDVKAIRRSLLDGSDTQFVVTSQVSHPDGIAVDWIARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDGM
ERVVMVNTSLGWPNGLALDYDEHKIYWGDAKTDKIEVMNMDGTGRLVLVEDKLPHIFGFT
LLGDYIYWTDWQRRSIERVHKRTAEREFIIDQLPDLMGLKATYVHKSFGTNPCAENNGGC
SPLCLYKPQGVQCGCPIGLELITDMSTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLT
GVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQGLVWEGFDSFTTLRXPYLHRYMYWTEWGGKPKIDRAAMD
GTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQDREVIADDLPHPFGLT
QYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNGH
CSHLCLAVPISSFVCSCPAHFSLNYDNKTCSGETVLQCLFSLSDXXNRMVIDEQQSPDII
LPIHSLRNVRAIDYDPLDKHLYWIDSKQNIIRRAQEDGNQSMTVVSSSLGGSIQGLQLYD
LSIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLLE
RSPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIV
IADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELD
MREYSKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPEQFSCTS
GEVDCIPQAWRCDGYPECDDSSDEEDCPVCSESEFQCDSRQCIDLSLRCNGEVNCQDRSD
ENKCEVRCPPDQFSCANGQCIGKHKKCDNNMDCTDNSDEIGCYPTEEPPPPPNNTIGSIV
GVVMVLFVVGAVYFVCQRVLCPQMKDDGETVTNDFVVHGSSSVPLGYVPHPSSLSSSLPG
MSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQY
TMEFGYSSNSPSTHRSYSYRPYPYRHFAPSHYETLQSPERTRAYARMCLGSLVSPLDKTS
QHLPRRSRHVT
Download sequence
Identical sequences XP_020469095.1.23826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]