SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020641436.1.8467 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020641436.1.8467
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-55
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-55
Family YWTD domain 0.00000142
Further Details:      
 
Domain Number 3 Region: 331-569
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 935-1195
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-38
Family YWTD domain 0.0000336
Further Details:      
 
Domain Number 5 Region: 889-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000838
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000245
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000487
Family EGF-type module 0.008
Further Details:      
 
Domain Number 9 Region: 1248-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000525
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 11 Region: 1205-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000569
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020641436.1.8467
Sequence length 1613
Comment low-density lipoprotein receptor-related protein 6 isoform X1 [Pogona vitticeps]; AA=GCF_900067755.1; RF=representative genome; TAX=103695; STAX=103695; NAME=Pogona vitticeps; AL=Scaffold; RT=Major
Sequence
MGAVLRSLLVCGLCSLTKASPLLLYANRRDLRLVDAAQVNDNATVVVGGLEDAAAVDFVF
IHGLIYWSDVSEEAIKRTEFNRTGSVQNVVISGLLSPDGIACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIITAD
IYWPNGLTLDYEEQKLYWADAKLNFIHRSNLDGSHRQPVIKGSLPHPFALTLFGDTLYWT
DWTTRSVLACNKYTGENLREIHTNIFSPMDIHVFSQQRQPNATNPCGTNNGGCSHLCLMS
PFKPFYQCACPTGVKLLENEKICKDGAVELLLLARRTDLRRISLDTPDFTDIVLHLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSLIDGSASQFVVQAQIAHPDGIAVDWIARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLNPMFGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYIENKIYWGDAKTDKIEVMNTDGTGRRVLVEDKLPHIFGFTL
LGDYIYWTDWQRRSIERVHKQTAEREVIIDQLPDLMGLKATNVHQIIGTNPCAESNGGCS
HLCLFRPQGLRCACPIGLELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYVKRRLYWTDLDTNLIESSNMLGLDRDVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTVIQNHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNSDNKTCSAPTSFLLFSQKNAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLEKQLYWIDSRQNVIRRSQEDGSQSFTVVMSPVPNQNLDIQPYDLS
IDIYSRYVYWTCEATNVINVTHLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERS
PPKIERAALDGTEREVLFSNGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVL
EDSNILQPIGLTVFENWLYWIDRHQQMIEKIDMTRQEGRTKVQARIAQLSDIHAVKELNM
QEFRQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQHFTCFTG
EIDCIPVAWRCDGFTECEDASDEKNCPVCSESQFQCESGQCIDRALQCNGEPNCQDSSDE
KKCEVLCLTDHFRCASGQCIGKNKKCDEHFDCSDSSDELGCYTTEEPAPQATNTIGSIIG
VILTVFIVAAMYFVCQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGM
SRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYT
MEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVMTAVGKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_020641436.1.8467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]