SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020734842.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020734842.1.74333
Domain Number 1 Region: 28-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-91
Family Calponin-homology domain, CH-domain 0.00000311
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-33
Family Spectrin repeat 0.0000959
Further Details:      
 
Domain Number 3 Region: 2175-2294
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-33
Family Pleckstrin-homology domain (PH domain) 0.0000176
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-29
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-28
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 6 Region: 1850-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-28
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.03e-26
Family Spectrin repeat 0.00000551
Further Details:      
 
Domain Number 8 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 6.98e-26
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 1228-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 3.38e-23
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 10 Region: 1532-1672
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-22
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 11 Region: 425-529
Classification Level Classification E-value
Superfamily Spectrin repeat 9.55e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 6.19e-20
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 13 Region: 528-636
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-18
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000461
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 15 Region: 1389-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000209
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020734842.1.74333
Sequence length 2331
Comment spectrin beta chain, erythrocytic [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MTSATELENVGNQPPYSRINARWDGPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLREQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVINFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFEV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLAGVQQQLQAFSTYRTIEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRGELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELELENYHDQKRITARKDNILRLWDYLQELLGARRQRLEKTLDLQKLFQDMLHS
IDWMDGIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITTATLQFTEGSGY
QPCDPQVIRDRVSHLEKCFEELSNTAAGRKAQLEQSKQLCKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLDQIFREAEDMVARKQFGYERIEVRIKK
VSDQWNELKDLAAFCKKNLQDTENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LEKKHKDFLEELEESRGVMQHLEQQAQDFPPGFQDSPDVTNRLQALRDLYQQVVAQADLR
RQRLQDALDLYTVFGETDACLLWMGEKEKWLAQMEIPDTLEDLEVVQHRFDILDQEMKTL
MSQIDGVNLAANSLVESNHPRSAEVKKCQDNLNTRWQDFQTMVSERREAVDSALRVHNYC
VDCEETGKWIVDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQTRLGMLERESQR
LMQSHPELKTDIEQRQAYVEELWQGLKQALKSQEASLGEASQLQAFLQDLDAFQAWLSTT
QKDVASKDMPESLPEAEQLLQQHAAIKDDIDRHQESYQKVRVSGERVTHGQTDPEYLLLG
QRLDGLEKGWDALSRMWESRSQALTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEFPDSL
EAAEAGIRKFEDFLVSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNN
EKAQESSELLKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASHQGWLENLDAEGKQLMEEKPQFAALVSQKLEALHRLWDELQANTQETAQHLSAARS
SDLRSQTQADLNKWIRAMEDQLQSDDLGKDLTSVNRMLAKLKRVEDQVNVRKEELEELFA
QMPSLGEEAGDEDLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSTDYGTNLQTVQLFVKKNQTLQNEILGHTPRVEDVLHRAQQLVAAAEIDCRDVEERLG
QLQGLWDTLREAAAGRLQRLREASEAQQYYLDAGEAEAWIGEQEFYVFSDENPQDEESAI
VMLKRHLRQQRAVEEYGRNIKQLAGRAQGLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERRRKLENMYHLFQLKREVDDLEQWIAEKDTVASSSEMGQDFDHVTVLRDKFRDFARETG
AIGQERVDNVNAVIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLQ
RYFYTGSEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGEQVQQFQDVAT
RLQTAYAGEKADIIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMVRDLLSWMD
SIIRQIETQEKPRDVSSVELLMKYHQGIRAEIETRSKNFSTCLELGESLLQRQHQASDEI
REKLEQVVSRREEMKEKWEARWERLRMLLEVCQFFRDASVAEAWLIAQEPYLASRDYGHT
VDSVEKLIKRHEAFEKSAASWEERFAALEKPTTLELKERQTPERTEEEPGLQEEEGETAG
EAPRGPHQATTERTSPGEEERPWPQDLQPPPPPGPHEDGQEEKSSTDERPATEPLFKVLD
TPLSEGDEPTTLPAQRDRGHSVQMEGFLGRKHDLEGPNKRASNRSWNNLYCVLRNSELAF
YKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEML
SWLQGVSTAINESQSIRVKAQSLPLPPITGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_020734842.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]