SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020739325.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020739325.1.74333
Domain Number 1 Region: 127-255
Classification Level Classification E-value
Superfamily DNA clamp 1.66e-47
Family DNA polymerase processivity factor 0.000000356
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily DNA clamp 2.6e-42
Family DNA polymerase processivity factor 0.000000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020739325.1.74333
Sequence length 261
Comment proliferating cell nuclear antigen [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences A0A212CAQ0 A0A287ABG2 D2HQS7 E2R0D6 L5JZR7 M3WAR4 M3Y491 S9WSK4 U6DX35
9615.ENSCAFP00000009045 ENSMPUP00000006142 NP_001278854.1.46622 XP_002924870.1.58354 XP_003983789.1.62641 XP_004014389.1.66739 XP_004398263.1.74151 XP_004687247.1.23501 XP_004751576.1.14098 XP_005688224.1.57651 XP_006047810.1.26621 XP_006187147.1.101512 XP_006207423.1.17985 XP_006735553.1.47382 XP_006921679.1.64745 XP_007073295.1.5354 XP_007114767.1.24612 XP_007191771.1.59432 XP_008701541.1.72690 XP_008834124.1.79516 XP_010992904.1.51371 XP_011995470.1.54773 XP_014933648.1.86478 XP_015985122.1.101085 XP_019318154.1.44245 XP_019500175.1.44202 XP_019500176.1.44202 XP_019500177.1.44202 XP_019500178.1.44202 XP_020739325.1.74333 XP_021544742.1.83697 XP_534355.3.84170 ENSSSCP00000020171 ENSCAFP00000009045 ENSVPAP00000006517 ENSVPAP00000006517 ENSCAFP00000009045 ENSSSCP00000020171 ENSAMEP00000009571 ENSAMEP00000009571 ENSMPUP00000006142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]