SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020772669.1.12261 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020772669.1.12261
Domain Number 1 Region: 72-310
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-91
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 2201-2319
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-37
Family Pleckstrin-homology domain (PH domain) 0.00000391
Further Details:      
 
Domain Number 3 Region: 329-450
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-35
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 4 Region: 1679-1834
Classification Level Classification E-value
Superfamily Spectrin repeat 1.12e-30
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 1044-1200
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-30
Family Spectrin repeat 0.0000282
Further Details:      
 
Domain Number 6 Region: 637-767
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-29
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 7 Region: 1257-1410
Classification Level Classification E-value
Superfamily Spectrin repeat 5.11e-28
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 8 Region: 1573-1727
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 9 Region: 1892-2046
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 10 Region: 850-985
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-26
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 11 Region: 728-844
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-25
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 12 Region: 459-562
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-23
Family Spectrin repeat 0.00034
Further Details:      
 
Domain Number 13 Region: 563-671
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-21
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 14 Region: 1418-1516
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-18
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 15 Region: 2051-2112
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020772669.1.12261
Sequence length 2375
Comment spectrin beta chain, non-erythrocytic 1 isoform X1 [Boleophthalmus pectinirostris]; AA=GCF_000788275.1; RF=representative genome; TAX=150288; STAX=150288; NAME=Boleophthalmus pectinirostris; AL=Scaffold; RT=Major
Sequence
MEFQSATTAGLPGPLSPGPLSPSSDYAGAVSPSGLPGPSHRGSPGRGSSPSRSPIRGASP
GPSYSGQAAFNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLSRVSCRITDLYMDLRDGR
MLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLT
LGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGM
AFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSI
ITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILN
NRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREG
KLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVS
QDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAESYHDIKRITARKDNV
IRLWEYLLELLKARRHRLEMNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDL
LQKHALVEADIGIQADRVRNVNSNAQKFANDTDGYKPCDPQIIRDRVAHLDFCYQELSQL
AAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSEDYGKDLTGAVRLLSQHKAFEDE
MSGRGAHLQQTIRQGEELVANNHFGADKIKERIQDLQDQWAALERLSAVRKAKLQEACNQ
HQFQADADDIDTWMLDVLRIVSSVDVGHDEFSTQALVKKHKDVAEEISSYRPVIDALHEQ
SKTLPPEKANSEEVQSRLAGIEERYKEVAELTRLRKQALQDALSLYKMMSEANACELWID
EKEQWLISMEIPEKLEDLEVVQHRFESLEPEMNSQASRVAVVNQVARQLLHSGHPSEKEI
KTQQDTLNTRWGQFRDLVDQKKDSLNSALGVQNYHLECNETKSWIKEKTKVIESTQELGN
DLAGVMALQRKLTGMERDLAAIEDKLGDLDKEAERLASEHPEQSEAIKGQLQNINGVWAE
MKDTMKNREESLGEASKLQQFFRELDDFQSWLSRTQTAIASEDMPNTLTEAEKLLAQHEN
IKNEIRNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLS
QSHAYQMFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKIG
AVVDSGRRLVSDGNINADRIQEKVDSIESRRKKNREAASELLMRLKDNRDLQKFLQDCQE
LSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKDGQTLMAEKPE
TEAMVKEKLSALKGMWGDLEGTTQTKAKCLFDANKAELFTQSCADLDKWLENLDGQLMSD
DYGKDLTSVNILLKKQQMLESQVEVRQKEVEELQSQSQALSQEGKGSEEVDGQRVSVERR
FQSLQSPLQKRRDMLMASREIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLIKK
NQTLQKEIQGHQPRYDDIFERSQSVLRQNTPTAEAIKHRLSELQALWAQIRQETENRHQR
LSQAHEAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYADT
VHQLSSTSRGLVAAGHPDSERIGMRQSQVDKLYAGLKDLSEERRGKLDERFRLFQLNREV
DDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDAVNRLADELIN
AGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILNRILDKHKK
LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAVRLQSAYAGDKADDIQKREG
EVLEAWKNLLEAVEGRRVKLLDTGDKFRFFSMVRDLMLWMEDVIRLIEAQEKPRDVSSVE
LLMNNHQGIKAEIDARNDSFTACIELGKALLARKHYASEEIKEKLLQLTDKRKDMIDKWE
DRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAA
TWEERFAALERLTTMELLEVRRRQEEEERNRQPAVTEASPTEAAAREGEAAAQNGLPSDQ
ESPRDGVDGGEVVNGVSEPSPAGSPGATRKGKPSQAATLPHTKTDSPTSQLEGVLHRKHE
WEGHNKKASSRSWHNVYCVINQQEMGFYKDQKSASQGIPYHSEIPVSLKDAVCEVATDYK
KKKHVFKLKITDGNEYLFQAKDDEEMNTWISAISNAVSGDKGEVTPSSHSTPAPTARAQT
LPASVATTATAAESSPGKREKGDKEKRFSLFSKKK
Download sequence
Identical sequences XP_020772669.1.12261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]