SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020781873.1.12261 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020781873.1.12261
Domain Number 1 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-54
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-53
Family YWTD domain 0.000004
Further Details:      
 
Domain Number 3 Region: 332-570
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-52
Family YWTD domain 0.00000286
Further Details:      
 
Domain Number 4 Region: 936-1197
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-40
Family YWTD domain 0.0000382
Further Details:      
 
Domain Number 5 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000954
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000969
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 8 Region: 1288-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000119
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 589-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000011
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 286-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000678
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1205-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020781873.1.12261
Sequence length 1616
Comment low-density lipoprotein receptor-related protein 6 [Boleophthalmus pectinirostris]; AA=GCF_000788275.1; RF=representative genome; TAX=150288; STAX=150288; NAME=Boleophthalmus pectinirostris; AL=Scaffold; RT=Major
Sequence
MGVVLRTLLFSSFCFLIRAVPLLLYANRRDLRVVDVAHEKANATVVVGGLEDAAAVDYVF
SQGFIYWSDVSEEAIKRTVYNQSGASVVQTVIAGLASPDGLACDWLGNKLYWTDSETNRI
EVSELDGSLRKVLFWQELDQPRAIALDPTRGYMYWTDWGEIPKIERAGMDGTNRSIIIDK
EIFWPNGLTLDYSQQKLYWADAKHNFIHRSNLDGSSREVVVKGDLPHPFALTLFEDTLFW
TDWNTHSIHSCRKQTGGEQRIVHSNIFSPMDIHVFSPKRQPVVPSPCSVNNGGCSHLCLL
SPTKPFYQCACPTGVRLLEDGATCRNGATQMLLLARRTDLRHISLDTPDFTDIIMQVDDI
RHAIAIDYDPVEGYIYWTDDDVRAIRRSRLDGSEAEFVVTSQVSHPDGIAVDWIARNLYW
TDTGTDRIEVTRLNGTMRKILIAEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDGM
ERVVMVNTSLGWPNGLALDYTDRKIYWGDAKTDKIEVMNMDGTNRRVLVEDKLPHIFGFT
LLGDYIYWTDWQRRSIERVHKRTAEREFIIDQLPDLMGLKATYVHESFGTNPCAENNGDC
SHLCLYKPRGVQCGCPIGLELISDMQTCIVPEAFLLFSRHTDIRRVSLETNNNNVAIPLT
GVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSSLEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAMD
GTGRIMLVADVGRANGLTIDYAERRLYWTDLDTALIESSNMLGQDREVIADDLPHPFELT
QYQDYIYWTDWSQRIIGRANKTSGQNRTLIQGHLDYVMDILVFHSSRQGGWNACASTNGH
CSHLCLAVPVSSYVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVMDEQQSPDIIL
PIHSLRNVRAIDYDPLDKHLYWIDSKQNVIRRAQEDGNQSMTVVSTSIGGPTQGLQLYDL
SIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLLER
SPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIVI
ADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIPYLSDIHAVHELDM
REYSKHPCTWDNGGCSHICIVKGDGTTRCSCPIHLVLLQDELSCGEPPTCSPEQFSCTSG
EVDCIPQAWRCDGFAECDDSSDEDDCPVCSESEFQCDSRQCIDMSLRCNGEINCQDSSDE
NKCEVRCPPDQFSCSNGQCIGKHKKCDHNMDCTDNSDELGCYPTEEPPPPPNNTISSIVG
VVLALFGVGAIYFVCQRVLCPQMKDDSETVTNDFVVHGPSSVPLGYVPHPGSLSSSLPGM
SRGKSMIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQYT
MEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRVPLKSGAAAKGYT
SDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_020781873.1.12261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]