SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020790990.1.12261 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020790990.1.12261
Domain Number 1 Region: 23-290
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-54
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 2 Region: 341-582
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-52
Family YWTD domain 0.00000203
Further Details:      
 
Domain Number 3 Region: 642-903
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-51
Family YWTD domain 0.00000389
Further Details:      
 
Domain Number 4 Region: 951-1208
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-36
Family YWTD domain 0.0000686
Further Details:      
 
Domain Number 5 Region: 1336-1373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 907-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000394
Family EGF-type module 0.029
Further Details:      
 
Domain Number 7 Region: 1259-1298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 8 Region: 1299-1335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 9 Region: 599-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000576
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 10 Region: 295-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000359
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 11 Region: 1217-1269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020790990.1.12261
Sequence length 1639
Comment low-density lipoprotein receptor-related protein 5 [Boleophthalmus pectinirostris]; AA=GCF_000788275.1; RF=representative genome; TAX=150288; STAX=150288; NAME=Boleophthalmus pectinirostris; AL=Scaffold; RT=Major
Sequence
MGGLLLFFTLHCWLLSVAVDAKPLLLFANRRDIRLVDAEGVRGESAIVVSDLEDAAAVDF
LYDQGLIFWTDVSEEAIKQTHWNQSSNSLKEALGTGQSVVVAGLDSPDGLACDWLGRKLY
WTDSETNRIEVANLNGTSRKVLFWMDLDQPRAIALNPSEGYMYWTDWGEEPRIERAGMDG
TNRKVIVGADIYWPNGLTIDLVEHKLYWADAKLSFIHRANLDGTARETVVEGTLTHPFAL
TLSEGTLYWTDWQTRSIHACNKHSGDKTREILSGIYSPMDIQVLEAYRQPHIQTPCSDSN
GGCSHLCLLSPVPPFYSCACPTGVRLNLDNKTCKPGAEQVLFLARRTDLRRISLDLPDFT
DIVLQLDDIRHAIAIDYDPVEGYVYWTDDEVRAIRRSRMDGSNATTLVTTEIKHPDGIAV
DWVARNLYWTDTGTDRIEVTRLNGTSRKILISDNLYEPRAIVLDPMNGLMFWTDWGENPK
IERANLDGTERMLLVNTSLGWPNGLALDYSTGKLYWGDAKTDKIEVINVDGSNRQVLLED
KLPHIFGFTLLGDYIYWTDWQRRSIERVHKTTAVREIIIDQLPDLMGLKATKVTETNGTN
GCAVDNGGCSHLCFWRKQAVSCACPMGMELLSDMHSCVVPEAFLFFTNRDNIRSISLGTN
SNDVAIPLTGVKEVSALDFDVAEKRLYWTDIQAKTISRAYMNGSTIEHVIEFGLDYPEGM
AVDWMGRNIYWADTGTNRIEVARLDGHYHQVLICNNIDTPRYLDNPRSLALDPAQGYMYW
TEWGGRPRIAKAYMDGSTIVTLVDKVGRANGLTIDYVDHRLYWTDLDTYMIESTNMQGLQ
REIIIDDLPHPFGLTQYRDFIYWTDFNLRRIERADKRSGQNRTVVLQGQLELMLDILVFH
SSRQDGTNECSHNNGNCAHLCLATPAGAQCRCASHYTLNPDGHNCSSPSSFLLFTQKASI
SRMVLGEQSPDIVLPIHVLRNVRAVNYDPYERLIYWLDGRQNIRRAKDDGTMATMIGSSS
TLSVENQLHDLSLDPYSRHIYWTCETTNTINVQRMDGHNVGVVLKDETDKPRAIVVNAEK
GYMYFTTVQERSAKIEGASLDGTERESLFTTGLIRPVALALDHKLGKLFWADADLKRIES
SDLTGANRIVLQDSNILQPMDLTILGDHLYWIDRQQQMIERVDKLTGDSRTRIQGRISYL
TSIYAVEDTNPPDFASHPCFQSNGGCSHICIAKGDGTPRCSCPMHLVLLQDLLNCGDPPT
CSTEQFTCSTGEIDCIPMAWRCDGFPECDDRSDEENCPVCSAFQFQCDKGGCIDSQRRCN
GEPDCADHSDEQDCEVFCAPNQFRCGDNQCITKKQQCDNYSDCADGSDELECDFISPSSS
GIPSTGSSTIGLVIAIILLVFMISGAYFVCQRVVCRRYKGPSSSFPHEYISGTPHVPLNF
IGPTNAQHGTFQGIACGKSMMSSVSLMGSSSSGAPLYDRNHVTGASSSSSSSTKGAFYPQ
ILNPPPSPATDRSLYNTEVFYSSNSPSTTRSYRPYHPVRGAAPPTTPCSTDVCDSDYNPH
PPVGLGSSAGRWKVTGYGNHGKHNKYYMDLNSDSDPYPPPPTPRSQYMSAEDSCPPSPST
ERSYFHLCPPPPSPCTDSS
Download sequence
Identical sequences XP_020790990.1.12261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]