SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020860370.1.61212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020860370.1.61212
Domain Number 1 Region: 28-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-93
Family Calponin-homology domain, CH-domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 294-415
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-33
Family Spectrin repeat 0.0000742
Further Details:      
 
Domain Number 3 Region: 600-740
Classification Level Classification E-value
Superfamily Spectrin repeat 6.87e-30
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 4 Region: 1639-1792
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-28
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 1010-1163
Classification Level Classification E-value
Superfamily Spectrin repeat 1.82e-28
Family Spectrin repeat 0.00000489
Further Details:      
 
Domain Number 6 Region: 1850-2004
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-27
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 1531-1686
Classification Level Classification E-value
Superfamily Spectrin repeat 2.03e-26
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 814-947
Classification Level Classification E-value
Superfamily Spectrin repeat 3.72e-23
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 9 Region: 424-526
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-22
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 10 Region: 1228-1374
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-22
Family Spectrin repeat 0.00091
Further Details:      
 
Domain Number 11 Region: 744-848
Classification Level Classification E-value
Superfamily Spectrin repeat 1.33e-19
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 12 Region: 528-635
Classification Level Classification E-value
Superfamily Spectrin repeat 4.48e-18
Family Spectrin repeat 0.00063
Further Details:      
 
Domain Number 13 Region: 1347-1439
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000017
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 14 Region: 2010-2069
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020860370.1.61212
Sequence length 2137
Comment LOW QUALITY PROTEIN: spectrin beta chain, erythrocytic [Phascolarctos cinereus]; AA=GCF_002099425.1; RF=representative genome; TAX=38626; STAX=38626; NAME=Phascolarctos cinereus; AL=Contig; RT=Major
Sequence
MTSATEFDNVGIQQYSRINARWDSPDNELDNDNSSARLFERSRIKALADEREVVQKKTFT
KWVNSHLARVSCRIADLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKALQ
FLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGQETRSAKDALLL
WCQMKTSGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFEKLKDSNARHNLEHAFDVA
ERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETE
KMIEKYSGLASDLLTWIEQTITVLNSRKFANSLSGLQQQLQSFSTYRTVEKPPKFQEKGN
LEVLLFTIQSRMRANNQKVYTPHEGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLE
QLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKAL
EDLAQELEKENYHDLKRIKARKDNILRMWSYLLDLLQSRRQRLEMTLTLQKLFQDMLHSI
DWIDEIKVHLLSSEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITSAALQFTDGKGYQ
PCDPQVIQDRVSHLELCFGELSSMAVGRKARLEQSKRLWKFFWDMDEAESWIKEKEQIYS
SLDYGKDLTSVLILQRKHKAFEDELXGLDAHLEQMMKEAEEMVAQKHFGHPQIEARIREV
SALWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRAL
GKKHKDFLEELEESRGVMEHLEQQAQSFPQEFRDSPDVNNRLQALRELYQQVVAQADLRR
QRLQDALDLYTVFGETDACELWMGEKEKWLNQMEIPDTLEDLEVVQHRFDILDQEMKTLM
AQIDGVNLAANSLVESGHPRSAEVKTCQDHLNLRWEAFQIMVSKCRKAVDSALSVHNYCV
DCEETGKWILDKTEVVESTKDLGRDLAGVIAIQRKLYGLERDVAAIQSRMGALERESQRL
IQEHPELQENIGNRQAYIEELWQKLQQALKGQEASLGEASQLQKFLQDLDDFQAWLFMAQ
KAVASEDAPDSLPEAEQLLQQHAAIKDEIDGHKDDYQNVKVSGEKVIQGQTDPEYQLLGQ
RLEGVDTGWDALCKMWENRGQFLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLE
AAEAGIRKFEDFLVSMENNQDKILNTVASGNKLVSEGNIYSDKIKEKVLLIEDRNKKNNE
KSQEAALLLRDNLDLQNFLQNCQELTLWINDKLLSSQDISYEEARNLHNKWQKHQAFMAE
LASNQGWLEKVDKEGRQLMEEKPQFTDVVTQRLRQLHRLWDELQSTTQEKAQHLFAASRS
DLHAQTYADLNKWISAMEDQLRSDDPGKDLTSVNRMLTKLKRVEDQVNVRKKELGELLSQ
VPPVGVEGDGTEPSIEKRFLDLLVPLGKRKKQLESSRAKLQINRDVEDETLWVEERLPLA
QSADYGTNLQSVQLLMKKNQTLQNEIVGHAPRIEDVLHRGHELVEVAEIDCQDIAERLGH
LQGSWKLLQDETAQRLRRLREANEAQQYYLDAGEAEAWISEQELYVISDETPKDEESAIV
MLKRHLRQQRSVEEYGKNIKQLAGRAQKLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAEE
RKRKLENMYHLFQLKREADDLEQWIAEREVVASSQEMGQDFDHVTLLRDKFRDFARETGA
IGQERVDNVNLIIERLIDAGHAEAATIAEWKDGLNEIWADLLELIDTRMQLLAASYDLHR
YFYLGEEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATR
LQTAYAGEKADEIQSKEQEVSTAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWMES
IIRQIETQEKPRDVSSVELLMKYHQGIKAEIETRSKNFSTCLELGESLLQRQHQASEEIK
EKLNQVMSRRQEMMEKWDNRSERLRLLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHTV
DSVEKLIKRHEAFEKSTATWAERFAALEKPTTLELKERQTPEKPTEDSGAQEEEGETAGE
PPRSLHRVTTERTSPVSSFSRLSSSWESLLPDPIHPS
Download sequence
Identical sequences XP_020860370.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]