SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020918019.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020918019.1.46622
Domain Number 1 Region: 294-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-51
Family SPRY domain 0.000027
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RING/U-box 2.52e-28
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 3 Region: 90-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.72e-18
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020918019.1.46622
Sequence length 487
Comment tripartite motif-containing protein 6 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MTSAVLVDIQEEVTCPLCLELLTDPLSIDCGHSFCQACITQNSEEWRMDQGGESSCPVCQ
TRYRPGNLRPNRHLANIAERLREVVLGSGTQLKVILCAHHGEKLQLFCREDGQLICWLCE
RAQEHRGHHTFLMEEVAQEYQERFQESLKKLRQEQQEAEKLAALIREKRASWKNQMEPER
HRIQKQFDQLRSILDKEEQRQLRKLEEEERKGLSVIAEAEGELLQQSQSLRELISDLERR
CQGSMTELLQDVRDVAERSEFWTLKKPEALPTKLKSVFRAPDLKKMLRVFRELTDVQSYW
VDVTLNPHTANLNLVLSKNRRQVRFVGAQQSGSRLDEHYGCGVLGSRHFSSGKHYWEVDV
AKKTDWILGVCSDAMAPTFSFSQFAAGRNVYSRYQPQSGYWVIGLHRKHEYRAYEDSSAS
LLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPSTLCPYFNPCNCVVPM
TLRRPSS
Download sequence
Identical sequences XP_020918019.1.46622 ENSSSCP00000028656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]