SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020938380.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020938380.1.46622
Domain Number 1 Region: 7-267
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-55
Family YWTD domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 619-874
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-54
Family YWTD domain 0.00000581
Further Details:      
 
Domain Number 3 Region: 318-548
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-50
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 4 Region: 921-1180
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-40
Family YWTD domain 0.0000719
Further Details:      
 
Domain Number 5 Region: 1316-1354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1271-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1231-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 877-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000163
Family EGF-type module 0.03
Further Details:      
 
Domain Number 9 Region: 574-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000303
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 10 Region: 273-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000195
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1188-1240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020938380.1.46622
Sequence length 1599
Comment low-density lipoprotein receptor-related protein 5 isoform X3 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MLFRPSPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEA
IKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLF
WQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSSRKVIVDSDIYWPNGLTIDLEE
QKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKR
TGEKRKEILSALYSPMDIQVLSPERQPYFHTRCEEDNGGCSHLCLLSPREPYYACACPTG
VQLQGNGQTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGY
VYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLN
GTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGESPKIECAHLDGQERHVLVNTSLGWPN
GLALDLQEGQLYWGDAKTDKIEVINIDGTERRTLLEDKLPHIFGFTLLGDFIYWTDWQRR
SIERVHKVKASRDIIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPRATKCG
CPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLDTNNNDVAIPLAGVKEASALDFDVST
NHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVAR
LDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNGMTLVDKVGRA
NDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLH
SIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAVPSGHRC
SCASHYTLDPSSRNCSPPTTFLLFSQKCAVSRMIPDDQHSPDLILPLHGLRNVRAIDYDP
LDKFIYWVDGRQNIKRAKDDGTQPFVLTSPGQSQSPDRQPHDLSIDVYGRTLFWTCEATN
TINVHRLNGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVL
FTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGKH
LYWIDRQQQMIERVDKTTGDSRTRVQGRVAHLTGIHAVEDISVEEFSAHPCARDNGGCSH
ICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPEC
DDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDASLNARPLLAAVC
LPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKLPSDDSPAHSSAIGPVIGIILS
LFVMGGVYFVCQRVVCQRYAGATGPFPHEYVSGTPHVPLNFIAPGGSQHGPFPGISCSKS
MMSSVSLMGGRAGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNLDVF
YSSNIPAAARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPP
PTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_020938380.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]