SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020938381.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020938381.1.46622
Domain Number 1 Region: 32-292
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-55
Family YWTD domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 644-899
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-54
Family YWTD domain 0.00000581
Further Details:      
 
Domain Number 3 Region: 343-573
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-50
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 4 Region: 946-1205
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-40
Family YWTD domain 0.0000719
Further Details:      
 
Domain Number 5 Region: 1341-1379
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1296-1332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1256-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 902-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000154
Family EGF-type module 0.03
Further Details:      
 
Domain Number 9 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000284
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 10 Region: 298-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000186
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1213-1265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020938381.1.46622
Sequence length 1516
Comment low-density lipoprotein receptor-related protein 5 isoform X4 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MEAAPPRPPPPPPPLLLLLALCCSLAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGM
DGSSRKVIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSPERQPYFHTRCEE
DNGGCSHLCLLSPREPYYACACPTGVQLQGNGQTCKAGAEEVLLLARRTDLRRISLDTPD
FTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGI
AVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGES
PKIECAHLDGQERHVLVNTSLGWPNGLALDLQEGQLYWGDAKTDKIEVINIDGTERRTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDLMGLKAVNVAKVVG
TNPCADRNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLD
TNNNDVAIPLAGVKEASALDFDVSTNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWG
GKPRIVRAFMDGTNGMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVI
ADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQD
GLNDCMHNNGQCGQLCLAVPSGHRCSCASHYTLDPSSRNCSPPTTFLLFSQKCAVSRMIP
DDQHSPDLILPLHGLRNVRAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPGQSQS
PDRQPHDLSIDVYGRTLFWTCEATNTINVHRLNGDAMGVVLRGDRDKPRAIVVNAERGYL
YFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDL
SGANRLTLEDANIVQPVGLTVLGKHLYWIDRQQQMIERVDKTTGDSRTRVQGRVAHLTGI
HAVEDISVEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSP
DQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEA
DCQDRSDEADCDASLNARPLLAAVCLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCE
ITKLPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGATGPFPHEYVSGTP
HVPLNFIAPGGSQHGPFPGISCSKSMMSSVSLMGGRAGVPLYDRNHVTGASSSSSSSTKA
TLYPPGHTRGRCGPAG
Download sequence
Identical sequences XP_020938381.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]