SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020953422.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020953422.1.46622
Domain Number 1 Region: 404-694
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.52e-76
Family Protein kinases, catalytic subunit 0.000000285
Further Details:      
 
Domain Number 2 Region: 248-331
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 2-91
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-21
Family I set domains 0.029
Further Details:      
 
Weak hits

Sequence:  XP_020953422.1.46622
Domain Number - Region: 107-194
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00222
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020953422.1.46622
Sequence length 874
Comment inactive tyrosine-protein kinase transmembrane receptor ROR1 isoform X3 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDT
TDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIG
NRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPK
PRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPM
ADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCR
NPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIALLFF
FICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECA
FGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVT
QEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGM
EYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMPPEA
IMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYS
LMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSNLSN
PRYPNYMFPSPGITAQGQIAGFISPPIPQNQRFIPVNGYPIPPGYAAFPAAHYQPAGPPR
VIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGITVFG
NKSQKPYKIDSKQPSLLGDANIHGHTESMISAEL
Download sequence
Identical sequences ENSSSCP00000004123 XP_020953420.1.46622 XP_020953422.1.46622 XP_020953423.1.46622 ENSSSCP00000004123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]