SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020953701.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020953701.1.46622
Domain Number 1 Region: 210-339
Classification Level Classification E-value
Superfamily TPR-like 2.09e-27
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 
Domain Number 2 Region: 96-180
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000293
Family FKBP immunophilin/proline isomerase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020953701.1.46622
Sequence length 349
Comment FK506-binding protein-like isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
METPPVSPLGEKNISQPQQRWKKNSQKILDSTTQIRQQPQDPSTELLEGRVSPDPAGQIL
ENLQEIEKLAVGREGDSDKSHGPASEMPEPLQASELWYCPDGSFVKKILIHGHGLDKPKL
GSRCRVQVLGFPLGSGLPEGWTELTMGLGPWREETWGELVEKCLESMCQGEEAELQLPGR
SGPPVRLKLASFTQGRDSWELEPTEKEALAREERARGTELFRAGNPEGAARCYGRALRLL
LTLPPPGSPERTVLHANLAACQLLLGQPHLAAQSCDRVLEREPGHLKALYRRGVAQAALG
NLDKATADLKKVLAVDPKNRAAQEELGKVIIQGKKQDAGLAQGLRKMFG
Download sequence
Identical sequences A5A8W3
ENSSSCP00000001534 NP_001121957.1.46622 XP_005665882.1.46622 XP_013833108.1.46622 XP_020953701.1.46622 9823.ENSSSCP00000001534 ENSSSCP00000001534 ENSSSCP00000029958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]