SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_021064391.1.100879 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021064391.1.100879
Domain Number 1 Region: 524-743
Classification Level Classification E-value
Superfamily Bet v1-like 2.06e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 97-243
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-27
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021064391.1.100879
Sequence length 752
Comment collagen type IV alpha-3-binding protein isoform X1 [Mus pahari]; AA=GCF_900095145.1; RF=representative genome; TAX=10093; STAX=10093; NAME=Mus pahari; AL=Chromosome; RT=Major
Sequence
MQRSGFPVQLSPLPAPPPSLPVVTREGRRGPSSGGGAGRSAGVTATAADGWKGRLSSPLV
LLPRSARCQARRRRRGGRASSLFLFPPHSPERALLAVPSPDPSPQGLGACTGAARGAGAG
LLLGCRVSMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNTL
SYYKSEDETEYGCRGSICLSKAVVTPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAI
EQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILC
RQVDTLQKYFDVCADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPHVT
PRGINGIDFKGEAITFKATTAGILATLSHCIELMVKREESWQKRHDREVEKRRRVEEAYK
NVMEELKKKPRFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTS
LPSGDTFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMNYSLQDV
GGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWE
TTIENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINIAMICQTLVSPPEGDQEISRDNILCKITYVANVNPGGWAPAS
VLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_021064391.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]