SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_021238610.1.32913 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021238610.1.32913
Domain Number 1 Region: 420-675
Classification Level Classification E-value
Superfamily YWTD domain 9.68e-57
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 119-354
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-49
Family YWTD domain 0.00000418
Further Details:      
 
Domain Number 3 Region: 723-982
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-40
Family YWTD domain 0.0000386
Further Details:      
 
Domain Number 4 Region: 677-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 1113-1151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 1034-1074
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 375-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000019
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 8 Region: 1075-1111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 71-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000628
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 10 Region: 10-68
Classification Level Classification E-value
Superfamily YWTD domain 0.000000105
Family YWTD domain 0.0019
Further Details:      
 
Domain Number 11 Region: 992-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000856
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021238610.1.32913
Sequence length 1422
Comment low-density lipoprotein receptor-related protein 6 isoform X4 [Numida meleagris]; AA=GCF_002078875.1; RF=representative genome; TAX=8996; STAX=8996; NAME=Numida meleagris; breed=g44 Domestic line; AL=Chromosome; RT=Major
Sequence
MHSRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREIHSNIFSPMDIH
AFNQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCNDGATELLL
LARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFVNGS
GSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTLRKILISEDLEEPRAIV
LDPTVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKTD
KIEVMNADGTGRRVLVEDKLPHIFGFTLLGNYVYWTDWQRRSIERVHKRTAEREIIIDQL
PDLMGLKATNVRQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELINDMKTCIVPEA
FLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMN
GSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRA
LALDPAEGFMYWTEWGGKPKIDRASMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDT
NLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGH
LDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSAP
TTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKA
QEDGSQSLTVVTSPVPSQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVVL
KGSQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALAIDSQ
LGKLFWADSDLRRIESSDLSGANRVVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDM
TGREGRTKVQARIAQLSDIHAVKELNVQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPV
HLVLLQDELSCGEPPTCSPQQFTCYTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDTQ
FQCESGQCIDSALQCNGEANCQDNSDEKNCEVLCLTNQFRCASGQCIGKSKKCDHNLDCS
DSSDEQGCYTTEEPAPQPNNTIGSIIGVILTLFVVGAMYFICQRVLCPRMKGDGETMTND
YVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSS
SSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYRCITQNAQSLYMLTLSQ
KSPYHSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTATMAKGYTSDLNYDSEPVPPPP
TPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_021238610.1.32913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]