SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_021329554.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021329554.1.45394
Domain Number 1 Region: 486-662
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.35e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 187-291
Classification Level Classification E-value
Superfamily Histone-fold 4.57e-25
Family Nucleosome core histones 0.018
Further Details:      
 
Domain Number 3 Region: 841-951
Classification Level Classification E-value
Superfamily POZ domain 5.89e-20
Family BTB/POZ domain 0.0055
Further Details:      
 
Domain Number 4 Region: 103-179
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000647
Family Nucleosome core histones 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021329554.1.45394
Sequence length 1032
Comment ankyrin repeat and BTB/POZ domain-containing protein 2 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MAGTNSSNMKTLEDLTLDSGYGAGDSCKSLSLSSSKSNSQAFMNTPHRGNWWYYSGSMNS
RNNSWDTVNTVLPEDPEDIFSKCPRLPELEEFPWTEEDVGRVVRKGAGKGASFSAEAVRR
LATLMRRALIRISREAQRLSVMHCRCTKFEVQSAIRLVLSWALADHCVSATVKAISMYNM
SAGELLRKGKSARCGLVFSVGRFFRWMVDTRIAVRIHEYAAICLSACMEALVEEVGVRIL
MAEREGATPGCVLTAETLEGVINNDAELWGVLQHHEHLICGKNANGVLSLPAHFSPYTEG
RQTGLETREDAYAELELRTLEQALLATCVGSISELSDLVSRAMHHMQRLSSVRHGLSPAR
HARQQPVSWSPDALHTLYYFLRCPQMESMENPNLDPPRMALSKERPFLLLPPLMEWMRVA
IVHAEHRRSLLVDSDDVRQTARLLLPGLDCEPRLLKPECCFSSFRRLDAKAATDKFQLDL
GFRMLNCGRTDLIGQAIELLGPDGVNSMDDQGMTPLMYACSAGDEALVQMLIDAGANLDV
AVPMCSPKHPSVHADSRHWVALTFAVLHGHISVAQLLLDAGANVEGAAIRYGQENTSETP
LQLASAAGNYEMVSLLLARGADPLLRSQDSNTLTSSLYEDMNCFSHAAAHGHRNVLRKLL
SQPQKVREDVLSLEEILAEGVDGETQASGRNGHSLPPPPSPNLSLVSEDALPKLCKTRMK
ALQEASFYSAEHGYLDVTMELRSLGVPWKLHVWLESLRSAQQKSRAGVMLSLLRDFTSVK
EEDYCEELVSVGLPLMFNILKNSKNEAIIQQLGIIFSHCYGTAPLPPIQEKKAALAAQLD
PHFLNNQEMSDVTFLVEGKPFYAHGVLLLTASDRFKTLLAQNGSDSTQTRKDIEISNIKY
NIFQMMMSYLYCGGTESLKMGVSELLELLSAASLFQLGVLQRHCEILCAQNIDLDNAVNI
YHTAKANGAVELSTYCEGYFLQNMAVLLEREAFRVMILGSGARSGSGKDSLLEALEATLV
RRLRSLLVTSRV
Download sequence
Identical sequences F1QLH2
ENSDARP00000083546 ENSDARP00000083546 XP_001923186.1.45394 XP_009296329.1.45394 XP_021329553.1.45394 XP_021329554.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]