SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_021390790.1.53032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021390790.1.53032
Domain Number 1 Region: 597-852
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 295-529
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 3 Region: 21-245
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-41
Family YWTD domain 0.00000723
Further Details:      
 
Domain Number 4 Region: 900-1159
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-39
Family YWTD domain 0.0000414
Further Details:      
 
Domain Number 5 Region: 854-902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000957
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1212-1250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1290-1328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000232
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 552-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000242
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1252-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 248-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.009
Further Details:      
 
Domain Number 11 Region: 1169-1222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_021390790.1.53032
Sequence length 1577
Comment low-density lipoprotein receptor-related protein 6 isoform X3 [Lonchura striata domestica]; AA=GCF_002197715.1; RF=representative genome; TAX=299123; STAX=40157; NAME=Lonchura striata domestica; AL=Scaffold; RT=Major
Sequence
MGAILRSLLACSFCSLMRAAPLLLYANRRDLRLVDAAHGKENATVIVGGLEDAAAVDFVF
LKGLIYWSDVSEEAIKRTEFNKSGSIQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEAPKIERAGMDGSSRSIIVNTD
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHSKYSGEDLREIHSNIFSPMDIHAFS
QKRQPNATNPCGTNNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKSCKDGATALLLLAR
RTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFLDGSDSQ
FVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDP
MVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKTDKIE
VMNADGTGRRVLVEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKCTAEREIIIDQLPDL
MGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELISDMKTCIVPEAFLL
FSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSA
LEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALAL
DPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYTKRRLYWTDLDTNLI
ESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDY
VMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTF
LLFSQKNAINRMVVDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQED
GSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTHLDGRPMGVVLKGD
QDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALAVDGQLGK
LFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGR
EGRTKVQARIAQLSDIHAVKELNLQEYRQHPCSQDNGGCSHICIVKGDGSTRCSCPVHLV
LLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPLCSDSQFQC
ESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKSKKCDHNLDCSDSS
DEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTNDYVV
HGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSS
TKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTD
VCDSDYAPSRRVPAAATKGYSSDLNYDSEPVPPPPTPRSQYLSAEENCESCPPSPYTERS
YSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_021390790.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]