SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_021490005.1.76796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021490005.1.76796
Domain Number 1 Region: 644-899
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-55
Family YWTD domain 0.00000617
Further Details:      
 
Domain Number 2 Region: 32-292
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-54
Family YWTD domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 343-573
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-50
Family YWTD domain 0.00000248
Further Details:      
 
Domain Number 4 Region: 946-1203
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-38
Family YWTD domain 0.0000722
Further Details:      
 
Domain Number 5 Region: 1334-1370
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1296-1332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1255-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 9 Region: 902-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000323
Family EGF-type module 0.018
Further Details:      
 
Domain Number 10 Region: 298-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1213-1265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021490005.1.76796
Sequence length 1614
Comment low-density lipoprotein receptor-related protein 5 [Meriones unguiculatus]; AA=GCF_002204375.1; RF=representative genome; TAX=10047; STAX=10047; NAME=Meriones unguiculatus; strain=243; AL=Scaffold; RT=Major
Sequence
METAPTRAPPPPPPLLLLLALCCSLTPAAASPLLLFANRRDVRLVDAGGVKLESTIVASG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTFLNQTGTAAQSIVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAGM
DGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKWTGEKRKEILSALYSPMDIQVLSQERQPPFHTRCEE
DNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPD
FTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGI
AVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGEN
PKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINIDGTKRRTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVG
TNPCADGNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRISLE
TNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWG
GKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQDRMVI
ADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQD
GLNDCVHGNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMIP
DDQLSPDLVLPLHGLRNVKAINYDPLDKFIYWVDGRQNIKRAKDDGTQPFMLTSPSQGLS
PDRQPHDLSIDIYSRTLFWTCEASNTINVHRLDGDAMGVVLRGERDKPRAIAVNAERGYM
YFTNMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDL
SGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGI
HAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSP
DQFACATGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEA
DCQDRSDEANCDAVCLPNQFRCSSGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIP
THSSAIGPVIGIILSLFVMGGVYFVCQRVMRQRYTGASGPFPHEYVSGTPHVPLNFIAPG
GSQHGPFPGIPCSKSMMSSMSLVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPP
PSPATDPSLYNMDMFYSSNIPATTRPCRPYIIRGMAPPTTPCSTDVCDSDYSTSRWKTSK
YYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_021490005.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]