SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_021491235.1.76796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021491235.1.76796
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-33
Family Spectrin repeat 0.0000908
Further Details:      
 
Domain Number 3 Region: 2173-2291
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-32
Family Pleckstrin-homology domain (PH domain) 0.0000195
Further Details:      
 
Domain Number 4 Region: 1642-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-29
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 5 Region: 1009-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-29
Family Spectrin repeat 0.00000461
Further Details:      
 
Domain Number 6 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-27
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 1532-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-26
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 8 Region: 639-742
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-25
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 9 Region: 1228-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-24
Family Spectrin repeat 0.00091
Further Details:      
 
Domain Number 10 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-23
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-21
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 8.32e-19
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 13 Region: 520-640
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 14 Region: 1351-1447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000017
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 15 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021491235.1.76796
Sequence length 2328
Comment LOW QUALITY PROTEIN: spectrin beta chain, erythrocytic [Meriones unguiculatus]; AA=GCF_002204375.1; RF=representative genome; TAX=10047; STAX=10047; NAME=Meriones unguiculatus; strain=243; AL=Scaffold; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKTVPXVIDHAIET
EKMIEKYSGLASDLLTWIEQTISVLNSRKFANSLSGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRSELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVTQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKA
LEDLARELEKENYHDQKRIIARKDNVLRLWSYLQELLRSRRQRLEATLALQKLFQDMLHS
IDWMDEIKAHILSAEFGKHLLEVEDLLQKHRLMEADIAIQGDKVKAITAATLQFTEGKGY
QPCDPQVIQDRVSHLEQCFGELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLGQIFQEAEGMVAQKQFGHPQIETRVKE
VSAQWEHLKELAAFRKRDLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKEFLEELEESRGAMEHLEHQAQGFPEEFRDSPDVTSRLQALRKLYQQVMAQADLR
GQRLQDALDLYTVFGESDACELWMSEKGKWLDQMDIPTTLEDLEVVQHRFDILDQEMKTL
MAQIDGVNLAANNLVESGHPRSGEVKQYQDRLNKRWQAFQAVVSEQRQAVDSALRVNNYC
VDCEETSKWIVDKTKVVESTRDLGQDLAGVIAIQRKLSGLERDVIAIRDRVSALERESQH
LMESHPEQKEDIGQRQADVEKLWKGLQDALQGQELSLGEASKLQAFLQDLDDFQAWLSMA
QKAVASEDMPESLPEAEQLLQQHAAIKEDIDGHRDNYHQVKASGEKVIEGQEDPDYQLLG
QRLAGLDTDWDALRRMWESREHSLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
AAAEAGIRKFEDFLMSMKNNQDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHKKNN
EKAQEASVLLKDNLELQNFLQNCKELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFMA
ELTSHQGWLENIDAEGRQLMEEKPQFKNVVSERLEALHKLWDELQITTKAKTEQLSAARS
SDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKRVEDQVNLRKEELEELFA
EAPSLGAEAGDTDMSIEKRFLDLLEPLGRRRKQLELSKAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGQQLVKAAEIDCQDIEERLG
HLQGSWDTLREAAASRLQRLRDAHEAQQYYLDAGEAEAWISEQELYVFSDEPPKDEEGAI
VMLKRHLRQQRTVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERRQRLENMYHLFQLKREADDLEQWISEKEMVASSQEMGQDFDHVTMLRDKFRDFARETG
AVGQERVDNVNTIIEQLIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLH
RYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLSMQVQQFQEVAT
RLQTAYAGEKADAIQGKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWMD
SIIRQIETQERPRDVSSVELLLKYHQGIKAEINTRAKNFSTCLELGESLLQRQHQASEEI
REKLQQVMSRRQEMNDKWEARSDRLHMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPTEEPGPQEEEGETAG
EAPQVHHAATERTSPGEERGPRPQDLQPPPPPGHHKEEEKSAGDERPATEPLFKALDTPL
SEGDEPATLPAQRDLGNTVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSQLTFYKD
AKNLALGMPYHGEEPLALRHAICEVAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLLWL
QGMSTAINESQSIRVKAQSLPLPSLAGPDASLGKKEKEKRFSFFPKKK
Download sequence
Identical sequences XP_021491235.1.76796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]