SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_021547466.1.83697 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021547466.1.83697
Domain Number 1 Region: 40-134
Classification Level Classification E-value
Superfamily Histone-fold 4.74e-88
Family Nucleosome core histones 0.00000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_021547466.1.83697
Sequence length 136
Comment histone H3.3 [Neomonachus schauinslandi]; AA=GCF_002201575.1; RF=representative genome; TAX=29088; STAX=29088; NAME=Neomonachus schauinslandi; AL=Scaffold; RT=Major
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
Download sequence
Identical sequences A0A016SGD9 A0A023EFX8 A0A023FGI2 A0A023GEV8 A0A026W3F1 A0A034W9H6 A0A044TMQ9 A0A067RIF3 A0A069DP67 A0A076FGH2 A0A077JJ76 A0A087UWY9 A0A087YBS3 A0A091DTZ9 A0A091FND3 A0A091J5T4 A0A091T9P5 A0A091URS8 A0A096ZTP0 A0A096ZTP5 A0A098LZM5 A0A099ZFG6 A0A0A1WX38 A0A0A9XVM2 A0A0B1TQM8 A0A0B2W330 A0A0B6YB02 A0A0B8RXH6 A0A0C2GLY2 A0A0C9RXC8 A0A0D8XPT2 A0A0D9QXU6 A0A0E9WWD3 A0A0F8B676 A0A0J7KT64 A0A0K0JD75 A0A0K8R3K9 A0A0L0BQY0 A0A0L7RF03 A0A0L8FQM4 A0A0M3I147 A0A0M4DZX3 A0A0N0BKZ3 A0A0N4TLS2 A0A0N4U3U3 A0A0N4VCQ1 A0A0N4W9S7 A0A0N4Y291 A0A0N5AE37 A0A0N5CWY4 A0A0P4VS06 A0A0P4WMJ1 A0A0P6G7D7 A0A0Q3PGJ5 A0A0R3PQM0 A0A0R3Q8V2 A0A0U2V290 A0A131XII1 A0A131YET8 A0A142BM41 A0A151I5W4 A0A151IG43 A0A151JUN9 A0A151P3F7 A0A151XHD2 A0A154PIU8 A0A182EJC5 A0A182F6V8 A0A182HGR9 A0A182JI78 A0A182K343 A0A182KM99 A0A182LT94 A0A182N504 A0A182P5N0 A0A182RP06 A0A182THP3 A0A182VEZ8 A0A182VQT0 A0A182X2P9 A0A183CG01 A0A183IUI7 A0A195DL45 A0A1A6G305 A0A1A7YYT8 A0A1A8DBW9 A0A1A8EV31 A0A1A8IFI8 A0A1A8LDL1 A0A1A8P8C3 A0A1A8U2I7 A0A1A9VWH5 A0A1A9X5M0 A0A1A9YMC7 A0A1A9ZAZ8 A0A1B0BIG8 A0A1B0DR07 A0A1B6C239 A0A1B6F9G4 A0A1D1W927 A0A1D1ZDV0 A0A1D2N918 A0A1E1X079 A0A1I8B001 A0A1L8DX09 A0A1L8EMY5 A0A1R8W905 A0A1S3AKR8 A0A1S3DJ09 A0A1S3GZE3 A0A1S3IKJ9 A0A1U7QAZ8 A0A1U7RE43 A0A1U7STZ2 A0A1V4JJ48 A0A1V9X459 A0A1W0WTD2 A0A1W4UXC0 A0A1W4XD24 A0A1W5AGY3 A0A1W6EVT3 A0A1W7RAI8 A0A1W7RGT3 A0A1Y1NFQ8 A0A210QYB4 A0A212FIJ6 A0A218UD00 A0A224XNS0 A0A224YPP5 A0A226NLU6 A0A226P6D3 A0A232F0L1 A0A238BX73 A0A249JKI1 A0A250Y9U3 A0A286Q4Z2 A0A286Q504 A0A286Q511 A0A286Q515 A0A286Q516 A0A286Q519 A0A286Q525 A0A2A2L584 A0A2A3EAE6 A0A2A4JKR4 A0A2C9JG40 A0A2D4NJC6 A0A2G9SKU8 A0A2G9UTG9 A0A2H1X3G9 A0A2H6N1Z1 A0A2I0T345 A0A2I4BRU8 A0A2I9LP18 A0A2K5CH32 A0A2K5JWR5 A0A2K5MWI8 A0A2K5RKM4 A0A2K5YRR3 A0A2K6B875 A0A2K6G4Y8 A0A2K6JPU2 A0A2K6NFE8 A0A2K6UZS9 A2I415 A5A6I2 A6YPD4 A9JTR4 A9RA98 B0BMY8 B0XCF6 B1NFB1 B2GSF5 B2R4P9 B3MP97 B3N4S2 B4GSJ5 B4I1C5 B4JAT0 B4KGS7 B4LTW3 B4MTP7 B4Q3I4 B5DG71 B5FZ57 B7P7T4 C0HL66 C0HL67 C1BEZ2 C1BJS3 C1BUS8 C1C0Y7 C3KIV1 C3Z739 C4N1A2 C9S275 D2HD52 D2N2Q0 D3TRJ3 D4AFL1 D6WZ25 E0VX16 E2AWV8 E2BMC5 E2J7D3 E2R6K5 E3TC12 E3TF38 E6ZGH8 E9H1C5 F0JA43 F1L1Z8 F4WA39 F6QR30 F6SLH3 F6YXV8 F7F1M9 F7G6P0 F8J4L3 G1FKE7 G1KGC9 G1MZV0 G1PSD0 G1S9T1 G2HIR8 G3NN16 G3RUH9 G3T157 G3VU19 G5BAP1 G7NTV6 H0V3S0 H0XM20 H2LU55 H2N3J5 H2SH61 H2XK16 H2YQ60 H3A4Q6 H9HKR9 H9K759 I3KVL0 I3NCG3 I4DJS3 I4DMK5 J3JWY8 J3S4H6 J9BIN2 J9K611 K1PN42 K4GGV1 K7GJU1 K7IYI2 K9IWF0 K9IWF3 L5KL36 L7M6B6 L7X3U9 L8I0H3 L9L023 M1S6S1 M1XMS6 M3X0X3 M3YQU9 M4ADM8 M7B956 P84243 P84244 P84245 P84246 P84247 P84248 P84250 Q0ZDB5 Q177E2 Q1W2A9 Q29L01 Q2F687 Q4S9G0 Q5BQN9 Q5E9F8 Q66VG2 Q6KCE3 Q6P823 Q6PI20 Q6PI79 Q6XIQ5 Q71LE2 Q7PUQ8 R0KCS8 R4G370 R4WNC0 R7TJ82 S4PTJ0 S4RNB1 T0MJ22 T1DKW9 T1FMU5 T1JIE5 T1PDD7 U3F815 U3JE91 U5EWX0 U5KN81 U6PZ56 V3ZQJ2 V9IIZ8 W2T161 W5JGZ9 W5KKM2 W5NA02 W5Q8W8 W8BWZ5
ENSPMAP00000005942 ENSPMAP00000006697 gi|116063361|gb|AAI23121| gi|147906226|ref|NP_001080065| gi|148231893|ref|NP_001086074| gi|148233109|ref|NP_001085048| gi|148236021|ref|NP_001079375| gi|148539598|ref|NP_001091902| gi|27370860|gb|AAH41218| gi|27503244|gb|AAH42290| gi|27769186|gb|AAH42309| gi|47506869|gb|AAH70966| gi|49522764|gb|AAH74158| gi|76780124|gb|AAI06303| gi|82237787|sp|Q6PI79| ENSLACP00000001165 ENSLACP00000004627 ENSNLEP00000001867 ENSNLEP00000016745 ENSNLEP00000022272 FBpp0071280 FBpp0078649 ENSTBEP00000005305 ENSTBEP00000014035 HGL_H00000355778-11 HGL_H00000355778-7 ENSMGAP00000004612 ENSGALP00000003584 ENSGALP00000031320 ENSGALP00000040613 ENSGALP00000040771 ENSPCAP00000004160 FBpp0221721 AAEL006158-PA RPRC008809-PA ENSCHOP00000008550 gi|115530764|gb|CAL49400| gi|160774424|gb|AAI55446| gi|163915477|gb|AAI57317| gi|163916070|gb|AAI57315| gi|301621375|gb|XP_002940033| gi|38174124|gb|AAH61408| gi|45360705|ref|NP_989026| gi|49903578|gb|AAH77035| gi|52346112|ref|NP_001005101| gi|82237558|sp|Q6P823| ENSDORP00000007628 CPIJ017187|histone ENSDORP00000007628 ENSMPUP00000004520 ENSMPUP00000013708 gi|4504279|ref|NP_002098.1| gi|4885385|ref|NP_005315.1| ENSCAFP00000023742 ENSCAFP00000034160 ENSLAFP00000006774 ENSLAFP00000016544 ENSOGAP00000017160 ENSOGAP00000021623 ENSSHAP00000006674 ENSVPAP00000010732 ENSMUSP00000016703 ENSMUSP00000102062 ENSMUSP00000124509 ENSMUSP00000125104 Bm4100 ADAR007228-PA ENSGMOP00000015275 ENSGMOP00000015316 ENSGMOP00000015336 ENSGMOP00000018016 jgi|Capca1|152257|estExt_Genewise1.C_6100020 FBpp0195153 FBpp0200000 gi|193634279|ref|XP_001949594.1| gi|193688275|ref|XP_001949472.1| ENSVPAP00000010732 FBpp0256338 FBpp0262422 ENSPSIP00000010624 ENSPSIP00000018326 ENSPSIP00000020552 jgi|Dappu1|231307|estExt_fgenesh1_kg.C_610036 ENSAMEP00000010254 ENSAMEP00000015368 IC33419AbApep6010 IC33419AbApep775 ENSONIP00000019897 ENSONIP00000025156 ENSRNOP00000004329 ENSRNOP00000040434 DS10_00000265 DS10_00005114 ENSAPLP00000014655 ENSPPYP00000000166 ENSGALP00000003584 jgi|Helro1|185455 Bm1_29875 Bm1_40030 ENSTTRP00000015055 Ocbimv22010770m.p Ocbimv22015953m.p ENSXMAP00000000832 ENSXMAP00000002596 ENSXMAP00000012572 FBpp0071280 FBpp0071281 FBpp0071282 FBpp0078649 FBpp0305663 FBpp0305716 FBpp0305717 ENSLAFP00000006774 ENSLAFP00000016544 ISCW002300-PA ENSGGOP00000019458 ENSGGOP00000026903 ENSOCUP00000015809 ENSTGUP00000004328 ENSTGUP00000008564 ENSMODP00000007401 FBpp0071280 FBpp0071281 FBpp0071282 FBpp0078649 ENSNLEP00000001867 ENSNLEP00000016745 ENSNLEP00000022272 ENSXETP00000027509 ENSXETP00000049009 ENSXETP00000058030 MhA1_Contig116.frz3.gene27 ENSPTRP00000016407 ENSPTRP00000021631 AGAP001813-PA ENSCJAP00000023286 ENSCJAP00000025896 ENSCJAP00000040426 ENSCJAP00000041315 ENSCJAP00000041936 ENSACAP00000005900 ENSACAP00000007128 ENSACAP00000018165 ENSMICP00000001957 ENSMICP00000009528 ENSGGOP00000019458 ENSGGOP00000026903 ENSDARP00000006849 ENSDARP00000047268 ENSDARP00000066544 ENSDARP00000089753 FBpp0137546 FBpp0143594 ENSOARP00000010254 ENSOARP00000019160 ENSXETP00000027509 ENSXETP00000049009 ENSXETP00000058030 Hsal_07022--XP_001120696.1_APIME ENSMMUP00000021558 ENSMMUP00000028664 ENSMMUP00000037589 ENSMMUP00000037760 ENSFCAP00000003333 ENSFCAP00000020265 LH24891-PA LOAG_05159T0 LOAG_13971T0 ENSMUSP00000016703 ENSMUSP00000124509 ENSACAP00000005900 ENSACAP00000007128 ENSACAP00000018165 ENSPPYP00000000166 ENSGMOP00000015275 ENSGMOP00000015316 ENSGMOP00000015336 ENSGMOP00000018016 jgi|Lotgi1|150994|fgenesh2_kg.C_sca_75000008 ENSTRUP00000011674 ENSTRUP00000011743 ENSTRUP00000015496 ENSTRUP00000017612 ENSTRUP00000039814 ENSOCUP00000015809 ENSMPUP00000004520 ENSMPUP00000013708 ENSEEUP00000002037 ENSEEUP00000012558 ENSEEUP00000014315 ENSGACP00000006729 ENSGACP00000007644 ENSGACP00000011861 ENSGACP00000006729 ENSGACP00000007644 ENSGACP00000011861 ENSP00000254810 ENSP00000355778 ENSP00000355780 ENSP00000355781 ENSP00000465813 ENSP00000466020 ENSP00000468714 GSOIDT00011153001 GSOIDT00015628001 ENSSSCP00000018225 ENSSSCP00000026784 ENSP00000254810 ENSP00000355778 ENSP00000355780 ENSP00000355781 ENSP00000465813 ENSP00000466020 ENSP00000468714 ENSMODP00000007401 ENSCSAVP00000007468 ENSCSAVP00000015809 ENSCINP00000029998 ENSOANP00000002357 ENSPANP00000011001 ENSPANP00000011553 ENSPANP00000016156 FBpp0272861 FBpp0287752 FBpp0253024 FBpp0254305 AGAP001813-PA|hypothetical AGAP001813-PB|hypothetical Bmb012751 DPGLEAN11308-PA TC005398 ENSSHAP00000006674 ENSORLP00000009629 ENSORLP00000010883 gi|156548619|ref|XP_001608166.1| gi|156548623|ref|XP_001608174.1| ENSMUSP00000016703 ENSMUSP00000079816 ENSCPOP00000004239 ENSTNIP00000014465 ENSTNIP00000014583 ENSTNIP00000017348 ENSCHOP00000008550 FBpp0118912 FBpp0122363 ENSAMEP00000010254 ENSAMEP00000015368 ENSMMUP00000028664 ENSMMUP00000037589 ENSMMUP00000037760 ENSMMUP00000038421 ENSEEUP00000002037 ENSEEUP00000012558 ENSEEUP00000014315 ENSPTRP00000016407 ENSPTRP00000021631 ENSPSIP00000010624 ENSPSIP00000018326 ENSPSIP00000020552 vb|PHUM492720-PA|EEB17922.1|histone Cflo_06579--XP_001120696.1_APIME WUBG_01830T0 WUBG_06338T0 ENSCJAP00000023286 ENSCJAP00000025896 ENSCJAP00000040426 ENSCJAP00000041315 ENSCJAP00000041936 ENSRNOP00000004329 ENSRNOP00000040434 PB18138-RA PB18139-RA 10090.ENSMUSP00000016703 10090.ENSMUSP00000079816 10116.ENSRNOP00000004329 10116.ENSRNOP00000040434 10141.ENSCPOP00000004239 121224.XP_002430660 13616.ENSMODP00000007401 28377.ENSACAP00000005900 28377.ENSACAP00000007128 28377.ENSACAP00000011074 31033.ENSTRUP00000011674 31033.ENSTRUP00000011743 31033.ENSTRUP00000015496 31033.ENSTRUP00000017612 31033.ENSTRUP00000039814 51511.ENSCSAVP00000007468 51511.ENSCSAVP00000015809 59729.ENSTGUP00000004328 59729.ENSTGUP00000008564 69293.ENSGACP00000006729 69293.ENSGACP00000007644 69293.ENSGACP00000011861 6945.ISCW002300-PA 7070.XP_975889 7159.AAEL006158-PA 7165.AGAP001813-PA 7176.CPIJ017187-PA 7217.FBpp0118912 7217.FBpp0122363 7222.FBpp0145395 7222.FBpp0158629 7227.FBpp0071280 7227.FBpp0078649 7237.FBpp0272861 7237.FBpp0287752 7244.FBpp0229725 7244.FBpp0231648 7245.FBpp0256338 7245.FBpp0262422 7260.FBpp0253024 7260.FBpp0254305 7460.XP_001120696 7739.JGI117519 7739.JGI120758 7739.JGI120760 7955.ENSDARP00000006849 7955.ENSDARP00000047268 7955.ENSDARP00000066544 7955.ENSDARP00000087462 7955.ENSDARP00000089753 7955.ENSDARP00000101697 8090.ENSORLP00000009629 8090.ENSORLP00000010883 8364.ENSXETP00000027509 8364.ENSXETP00000049009 8364.ENSXETP00000058030 9031.ENSGALP00000003584 9258.ENSOANP00000002357 9361.ENSDNOP00000016436 9544.ENSMMUP00000028664 9544.ENSMMUP00000037589 9544.ENSMMUP00000037760 9544.ENSMMUP00000038421 9598.ENSPTRP00000016407 9598.ENSPTRP00000021631 9600.ENSPPYP00000000166 9606.ENSP00000254810 9606.ENSP00000355778 9615.ENSCAFP00000007332 9615.ENSCAFP00000023742 9685.ENSFCAP00000003333 9685.ENSFCAP00000005344 9796.ENSECAP00000005033 9796.ENSECAP00000014555 9823.ENSSSCP00000018225 9913.ENSBTAP00000034086 9913.ENSBTAP00000034581 9986.ENSOCUP00000015809 99883.ENSTNIP00000014465 99883.ENSTNIP00000014583 99883.ENSTNIP00000017348 SMAR013626-PA EKC17910 ENSXMAP00000000832 ENSXMAP00000002596 ENSXMAP00000012572 ENSP00000355778 ENSMICP00000001957 ENSMICP00000009528 ENSORLP00000009629 ENSORLP00000010883 ENSTBEP00000005305 ENSTBEP00000014035 ENSFALP00000001095 ENSTTRP00000015055 ENSCAFP00000034160 ENSCAFP00000037025 ENSECAP00000005033 ENSECAP00000014555 ENSLACP00000001165 ENSLACP00000004627 ENSMLUP00000014073 ENSMGAP00000004612 FBpp0145395 FBpp0158629 ENSBTAP00000034086 ENSBTAP00000034581 ENSAPMP00000015446 ENSPFOP00000002621 ENSPFOP00000002640 ENSPFOP00000002664 ENSPFOP00000018371 ENSSSCP00000018225 ENSSSCP00000026784 ENSDARP00000006849 ENSDARP00000047268 ENSDARP00000066544 ENSDARP00000089753 ENSDARP00000117879 ENSDARP00000120344 ENSDARP00000125972 ENSDARP00000126130 ENSPMAP00000005942 ENSPMAP00000006697 ENSCINP00000029998 ENSPCAP00000004160 ENSCPOP00000004239 ENSDNOP00000016436 FBpp0190657 FBpp0190938 ENSMEUP00000003719 ENSSTOP00000022060 GS_20732 FBpp0164096 FBpp0166201 ENSDNOP00000019564 ENSDNOP00000021722 ENSECAP00000005033 ENSECAP00000014555 ENSTNIP00000014465 ENSTNIP00000014583 ENSTNIP00000017348 4hga_B ENSONIP00000019897 ENSONIP00000025156 ENSLOCP00000014217 ENSLOCP00000017461 ENSOGAP00000017160 ENSOGAP00000021623 ENSTGUP00000004328 ENSTGUP00000008564 FBpp0229725 FBpp0231648 ENSMLUP00000014073 ENSFCAP00000003333 ENSFCAP00000005344 ENSOANP00000002357 ENSAMXP00000000846 ENSAMXP00000001632 ENSAMXP00000007420 ENSAMXP00000008134 Aech_10107 Aech_10109 NP_001005101.1.99540 NP_001014411.1.59421 NP_001014411.1.76553 NP_001017599.1.45394 NP_001026653.2.86415 NP_001079375.1.7800 NP_001080065.1.7800 NP_001085048.1.7800 NP_001086074.1.7800 NP_001091756.1.14763 NP_001092038.1.37143 NP_001164583.1.1745 NP_001184227.1.42559 NP_001184233.1.42559 NP_001191424.1.21191 NP_001229500.1.59421 NP_001229500.1.76553 NP_001259374.1.81976 NP_001260082.1.81976 NP_001267377.1.37143 NP_002098.1.87134 NP_002098.1.92137 NP_005315.1.87134 NP_005315.1.92137 NP_032236.1.92730 NP_032237.1.92730 NP_446437.1.100692 NP_446437.1.4139 NP_511095.1.81976 NP_523479.1.81976 NP_723056.2.81976 NP_727314.1.81976 NP_788892.1.81976 NP_956297.1.45394 NP_957395.1.45394 NP_989026.1.99540 NP_990627.1.86415 NP_999095.1.46622 XP_001355964.1.19638 XP_001368225.1.35504 XP_001608166.1.61660 XP_001608174.1.61660 XP_001657554.1.48696 XP_001867328.1.94360 XP_001897416.1.25112 XP_001899461.1.25112 XP_001962995.1.52611 XP_001966717.1.52611 XP_001968765.1.56816 XP_001977366.1.56816 XP_001989021.1.65300 XP_001992391.1.65300 XP_002001685.1.58863 XP_002010097.1.58863 XP_002021511.1.64850 XP_002025032.1.64850 XP_002037914.1.34323 XP_002043987.1.34323 XP_002051859.1.90633 XP_002058949.1.90633 XP_002064500.1.14588 XP_002071382.1.14588 XP_002078203.1.80810 XP_002088675.1.41174 XP_002101068.1.41174 XP_002134231.1.19638 XP_002399568.1.51680 XP_002430660.1.24195 XP_002589240.1.56174 XP_002595623.1.56174 XP_002664801.1.45394 XP_002728089.1.100692 XP_002732447.1.86028 XP_002732967.1.86028 XP_002745967.1.60252 XP_002748789.1.60252 XP_002760051.1.60252 XP_002760634.1.60252 XP_002802116.1.72884 XP_002809433.1.23681 XP_002919897.1.58354 XP_002926741.1.58354 XP_003131242.1.46622 XP_003140744.1.37734 XP_003149523.1.37734 XP_003211494.1.16129 XP_003216117.1.98722 XP_003217253.1.98722 XP_003222905.1.98722 XP_003249043.1.67334 XP_003263420.1.23891 XP_003275139.1.23891 XP_003275143.1.23891 XP_003275144.1.23891 XP_003275145.1.23891 XP_003279138.1.23891 XP_003308826.1.37143 XP_003386893.1.10788 XP_003400767.1.43243 XP_003400771.1.43243 XP_003400772.1.43243 XP_003410978.1.64505 XP_003417304.1.64505 XP_003435952.1.40869 XP_003438823.1.78416 XP_003449844.1.78416 XP_003461470.1.53824 XP_003462414.1.53824 XP_003485156.1.29386 XP_003506879.3.69978 XP_003694444.1.59471 XP_003708096.1.71094 XP_003708097.1.71094 XP_003739008.1.18380 XP_003748371.1.18380 XP_003752732.1.4139 XP_003767801.1.9362 XP_003786173.1.62490 XP_003791041.1.62490 XP_003813324.1.60992 XP_003814967.1.60992 XP_003930341.1.74449 XP_003931776.1.74449 XP_003961353.1.43653 XP_003970774.1.43653 XP_003997209.3.62641 XP_003999137.3.62641 XP_004013172.1.66739 XP_004013682.1.66739 XP_004028534.1.27298 XP_004041067.1.27298 XP_004076117.2.28442 XP_004080398.1.28442 XP_004084106.1.28442 XP_004271029.1.21590 XP_004275531.1.21590 XP_004374202.1.4749 XP_004375943.1.4749 XP_004394384.1.74151 XP_004439612.1.5094 XP_004450908.1.11602 XP_004476610.1.11602 XP_004557547.1.88231 XP_004562520.1.88231 XP_004567486.1.88231 XP_004578655.1.84141 XP_004592960.1.84141 XP_004605482.1.94378 XP_004641232.1.9945 XP_004641233.1.9945 XP_004691090.1.23501 XP_004693560.1.23501 XP_004748948.1.14098 XP_004761972.1.14098 XP_004860763.1.39548 XP_004918516.1.99540 XP_004999667.1.53824 XP_005010211.1.99704 XP_005056049.1.66865 XP_005069967.1.91757 XP_005078192.1.91757 XP_005141451.1.78019 XP_005190680.1.65292 XP_005243673.1.75256 XP_005289629.1.60341 XP_005289630.1.60341 XP_005297556.1.60341 XP_005332630.1.77405 XP_005349017.1.66349 XP_005350806.1.66349 XP_005404549.1.28644 XP_005448024.1.78416 XP_005523348.1.90289 XP_005526825.1.90289 XP_005541064.1.63531 XP_005585038.1.63531 XP_005608028.1.31192 XP_005721939.1.53837 XP_005740175.1.53837 XP_005751764.1.53837 XP_005755275.1.53837 XP_005803299.1.87360 XP_005804582.1.87360 XP_005804584.1.87360 XP_005809674.1.87360 XP_005815160.1.87360 XP_005904534.1.15283 XP_005906357.1.15283 XP_005923872.1.24487 XP_005926645.1.24487 XP_005926646.1.24487 XP_005939565.1.24487 XP_005947848.1.24487 XP_005959145.1.78601 XP_005987867.1.90931 XP_006012509.1.90931 XP_006013918.1.90931 XP_006013919.1.90931 XP_006013920.1.90931 XP_006016625.1.24877 XP_006018341.1.24877 XP_006037004.1.24877 XP_006045331.1.26621 XP_006046136.1.26621 XP_006046137.1.26621 XP_006118112.1.96668 XP_006136503.1.96668 XP_006145860.1.99106 XP_006157313.1.99106 XP_006176524.1.101512 XP_006188183.1.101512 XP_006198891.1.17985 XP_006199457.1.17985 XP_006220073.1.17985 XP_006265010.1.47583 XP_006268823.1.47583 XP_006269304.1.47583 XP_006532311.1.92730 XP_006563134.1.77095 XP_006563135.1.77095 XP_006616689.1.66377 XP_006616690.1.66377 XP_006616691.1.66377 XP_006627520.1.81211 XP_006635166.1.81211 XP_006637126.1.81211 XP_006748487.1.47382 XP_006750109.1.47382 XP_006797026.1.46954 XP_006801113.1.46954 XP_006808672.1.46954 XP_006869633.1.41390 XP_006886266.1.29581 XP_006897815.1.29581 XP_006912277.1.64745 XP_006993705.1.50099 XP_007067371.1.26238 XP_007071767.1.26238 XP_007072612.1.26238 XP_007099821.1.24612 XP_007128127.1.24612 XP_007167261.1.59432 XP_007185762.1.59432 XP_007240472.1.101067 XP_007240473.1.101067 XP_007240687.1.101067 XP_007240688.1.101067 XP_007256886.1.101067 XP_007427042.1.37977 XP_007436454.1.37977 XP_007436455.1.37977 XP_007454397.1.90284 XP_007454398.1.90284 XP_007454524.1.90284 XP_007534516.1.11023 XP_007536787.1.11023 XP_007556523.1.10163 XP_007561070.1.10163 XP_007576700.1.10163 XP_007576704.1.10163 XP_007577897.1.10163 XP_007577898.1.10163 XP_007577900.1.10163 XP_007577901.1.10163 XP_007626413.1.28591 XP_007645983.1.69978 XP_007670587.1.37387 XP_007884068.1.63211 XP_007886957.1.63211 XP_007896479.1.63211 XP_007935166.1.48129 XP_008009919.1.81039 XP_008047273.1.4292 XP_008047274.1.4292 XP_008048990.1.4292 XP_008153272.1.99482 XP_008173273.1.60341 XP_008173274.1.60341 XP_008173275.1.60341 XP_008173276.1.60341 XP_008186887.1.67334 XP_008188188.1.67334 XP_008197392.1.52716 XP_008266274.1.1745 XP_008280859.1.38333 XP_008282544.1.38333 XP_008301911.1.38333 XP_008312429.1.100486 XP_008312935.1.100486 XP_008330716.1.100486 XP_008424338.1.1237 XP_008424339.1.1237 XP_008426585.1.1237 XP_008434558.1.1237 XP_008436003.1.1237 XP_008436004.1.1237 XP_008481972.1.36046 XP_008535873.1.77740 XP_008543017.1.77740 XP_008552508.1.5247 XP_008552520.1.5247 XP_008564309.1.73410 XP_008579016.1.73410 XP_008579017.1.73410 XP_008691998.1.72690 XP_008693497.1.72690 XP_008829603.1.79516 XP_008964082.1.60992 XP_009004243.1.60252 XP_009014580.1.102002 XP_009064576.1.39240 XP_009092019.1.15306 XP_009290278.1.45394 XP_009474888.1.38621 XP_009566744.1.62272 XP_009636129.1.23211 XP_009861241.1.78797 XP_010000944.1.85724 XP_010217642.1.20684 XP_010352126.1.97406 XP_010356368.1.97406 XP_010360696.1.97406 XP_010371199.1.97406 XP_010376533.1.97406 XP_010379416.1.97406 XP_010380324.1.97406 XP_010385878.1.97406 XP_010565428.1.12557 XP_010565429.1.12557 XP_010576024.1.12557 XP_010576025.1.12557 XP_010576026.1.12557 XP_010576027.1.12557 XP_010576028.1.12557 XP_010576029.1.12557 XP_010576030.1.12557 XP_010576032.1.12557 XP_010576033.1.12557 XP_010577635.1.12557 XP_010595256.1.64505 XP_010611509.2.5607 XP_010616712.1.5607 XP_010616714.1.5607 XP_010616715.1.5607 XP_010734542.1.61708 XP_010739542.1.61708 XP_010739544.1.61708 XP_010768027.1.77114 XP_010770452.1.77114 XP_010776070.1.77114 XP_010851172.1.44457 XP_010869098.1.71217 XP_010887152.1.71217 XP_010890196.1.71217 XP_010896955.1.71217 XP_010949055.1.22495 XP_010972141.1.22495 XP_010990793.1.51371 XP_010996709.1.51371 XP_011069182.1.86870 XP_011069183.1.86870 XP_011069184.1.86870 XP_011069185.1.86870 XP_011141556.1.56509 XP_011141557.1.56509 XP_011141558.1.56509 XP_011158466.1.47049 XP_011158467.1.47049 XP_011158469.1.47049 XP_011158470.1.47049 XP_011158471.1.47049 XP_011183434.1.96551 XP_011206404.1.45957 XP_011265432.1.72520 XP_011298455.1.61867 XP_011298462.1.61867 XP_011346345.1.87679 XP_011346346.1.87679 XP_011346347.1.87679 XP_011359139.1.92234 XP_011360255.1.92234 XP_011420805.1.10878 XP_011441839.1.10878 XP_011480935.1.28442 XP_011503189.1.84716 XP_011503190.1.84716 XP_011557760.1.9062 XP_011583983.1.59079 XP_011585409.1.59079 XP_011598108.1.59079 XP_011635839.1.19355 XP_011635840.1.19355 XP_011635841.1.19355 XP_011707504.1.89273 XP_011707505.1.89273 XP_011707509.1.89273 XP_011707511.1.89273 XP_011718175.1.29376 XP_011734322.1.29376 XP_011744414.1.29376 XP_011758640.1.29376 XP_011804341.1.43180 XP_011804342.1.43180 XP_011804343.1.43180 XP_011804344.1.43180 XP_011836348.1.47321 XP_011836434.1.47321 XP_011876510.1.68811 XP_011876511.1.68811 XP_011895905.1.92194 XP_011895906.1.92194 XP_011897852.1.92194 XP_011897853.1.92194 XP_011907339.1.92194 XP_011925547.1.92194 XP_011932676.1.92194 XP_011965131.1.54773 XP_011966071.1.54773 XP_012063565.1.45171 XP_012063566.1.45171 XP_012234151.1.42766 XP_012234152.1.42766 XP_012234153.1.42766 XP_012234154.1.42766 XP_012234155.1.42766 XP_012244001.1.29386 XP_012244013.1.29386 XP_012244017.1.29386 XP_012258866.1.80111 XP_012269418.1.80111 XP_012273469.1.87881 XP_012307212.1.9421 XP_012309119.2.9421 XP_012315230.1.9421 XP_012343003.1.59471 XP_012343004.1.59471 XP_012362020.1.23891 XP_012362021.1.23891 XP_012362022.1.23891 XP_012362023.1.23891 XP_012368149.1.9945 XP_012415733.1.74151 XP_012499830.1.63892 XP_012499831.1.63892 XP_012517709.1.63892 XP_012529472.1.53737 XP_012529473.1.53737 XP_012529474.1.53737 XP_012529475.1.53737 XP_012606772.1.48125 XP_012634299.1.48125 XP_012674227.1.3086 XP_012678689.1.3086 XP_012694705.1.3086 XP_012718583.1.37407 XP_012719554.1.37407 XP_012723570.1.37407 XP_012728063.1.37407 XP_012728065.1.37407 XP_012777767.1.88231 XP_012777768.1.88231 XP_012786403.1.84141 XP_012859399.1.18182 XP_012893322.1.60039 XP_012933635.1.39548 XP_012933636.1.39548 XP_012990765.1.71217 XP_013007633.1.53824 XP_013086290.1.17457 XP_013114376.1.53170 XP_013114377.1.53170 XP_013128312.1.78416 XP_013128318.1.78416 XP_013143472.1.63905 XP_013169479.1.34343 XP_013199850.1.6669 XP_013297213.1.49812 XP_013301891.1.49812 XP_013398416.1.76062 XP_013773710.1.66592 XP_013775660.1.66592 XP_013775661.1.66592 XP_013775662.1.66592 XP_013776214.1.66592 XP_013776215.1.66592 XP_013777168.1.66592 XP_013782017.1.66592 XP_013786859.1.66592 XP_013795791.1.3284 XP_013797333.1.3284 XP_013809473.1.3284 XP_013809474.1.3284 XP_013870443.1.33752 XP_013879174.1.33752 XP_013885059.1.33752 XP_013887037.1.33752 XP_013914121.1.67126 XP_013930352.1.67126 XP_013930353.1.67126 XP_013930590.1.67126 XP_013992577.1.97760 XP_014012397.1.97760 XP_014012398.1.97760 XP_014013585.1.97760 XP_014014405.1.97760 XP_014014406.1.97760 XP_014017794.1.97760 XP_014017795.1.97760 XP_014017796.1.97760 XP_014034978.1.97760 XP_014053180.1.97760 XP_014069423.1.97760 XP_014069424.1.97760 XP_014069425.1.97760 XP_014086012.1.97495 XP_014086013.1.97495 XP_014213658.1.61449 XP_014213659.1.61449 XP_014241070.1.82534 XP_014241071.1.82534 XP_014241073.1.82534 XP_014241074.1.82534 XP_014241075.1.82534 XP_014241076.1.82534 XP_014268334.1.88231 XP_014270580.1.9445 XP_014270581.1.9445 XP_014270582.1.9445 XP_014301359.1.53796 XP_014301360.1.53796 XP_014347324.1.90931 XP_014348778.1.90931 XP_014348784.1.90931 XP_014367732.1.63768 XP_014428132.1.96668 XP_014435739.1.96668 XP_014467498.1.44477 XP_014467499.1.44477 XP_014616926.1.41157 XP_014616938.1.41157 XP_014616947.1.41157 XP_014644756.1.5094 XP_014663187.1.89999 XP_014695341.1.49734 XP_014717865.1.49734 XP_014732955.1.99236 XP_014744637.1.99236 XP_014772802.1.24776 XP_014787786.1.24776 XP_014806369.1.91963 XP_014806874.1.91963 XP_014822973.1.96476 XP_014825808.1.96476 XP_014825809.1.96476 XP_014834560.1.96476 XP_014836307.1.96476 XP_014836308.1.96476 XP_014841936.1.96476 XP_014871381.1.100837 XP_014871393.1.100837 XP_014872373.1.100837 XP_014881743.1.100837 XP_014881744.1.100837 XP_014889253.1.100837 XP_014895473.1.100837 XP_014895474.1.100837 XP_014970664.1.72884 XP_014975881.1.72884 XP_014975882.1.72884 XP_014981108.1.72884 XP_015032659.1.14588 XP_015118788.1.60272 XP_015118903.1.60272 XP_015172183.1.70865 XP_015172184.1.70865 XP_015172185.1.70865 XP_015196190.1.81211 XP_015215540.1.81211 XP_015230629.1.42780 XP_015238393.1.42780 XP_015245618.1.42780 XP_015245619.1.42780 XP_015245620.1.42780 XP_015251385.1.42780 XP_015269967.1.55130 XP_015279774.1.55130 XP_015279775.1.55130 XP_015284463.1.55130 XP_015339070.1.40921 XP_015359661.1.40921 XP_015367919.1.48343 XP_015371377.1.48343 XP_015399949.1.5354 XP_015418760.1.95426 XP_015434156.1.55303 XP_015434157.1.55303 XP_015464255.1.101067 XP_015478189.1.82291 XP_015501584.1.82291 XP_015509180.1.5119 XP_015509181.1.5119 XP_015588685.1.68462 XP_015590758.1.68462 XP_015590759.1.68462 XP_015674626.1.16292 XP_015675669.1.16292 XP_015680070.1.16292 XP_015680071.1.16292 XP_015743777.1.37977 XP_015781882.1.93521 XP_015796641.1.37898 XP_015796642.1.37898 XP_015796643.1.37898 XP_015816126.1.37898 XP_015818872.1.37898 XP_015819261.1.37898 XP_015848478.1.50099 XP_015918384.1.5422 XP_015918385.1.5422 XP_015918386.1.5422 XP_015983388.1.101085 XP_016012957.1.101085 XP_016038650.1.80810 XP_016067936.1.3490 XP_016076697.1.3490 XP_016084660.1.42290 XP_016092113.1.42290 XP_016092122.1.42290 XP_016106522.1.42290 XP_016106523.1.42290 XP_016142283.1.42290 XP_016142284.1.42290 XP_016286139.1.35504 XP_016309278.1.79318 XP_016309279.1.79318 XP_016309280.1.79318 XP_016314323.1.79318 XP_016324151.1.79318 XP_016324152.1.79318 XP_016324153.1.79318 XP_016327549.1.79318 XP_016327550.1.79318 XP_016330473.1.79318 XP_016348327.1.79318 XP_016348328.1.79318 XP_016357315.1.79318 XP_016361457.1.79318 XP_016361458.1.79318 XP_016370789.1.44103 XP_016370790.1.44103 XP_016370959.1.44103 XP_016370960.1.44103 XP_016370962.1.44103 XP_016380308.1.44103 XP_016380315.1.44103 XP_016382042.1.44103 XP_016382043.1.44103 XP_016416025.1.44103 XP_016430561.1.44103 XP_016430562.1.44103 XP_016531535.1.10163 XP_016805313.1.37143 XP_016850307.1.98722 XP_016916623.1.2121 XP_016916624.1.2121 XP_016916625.1.2121 XP_016939005.1.48971 XP_016939006.1.48971 XP_016945604.1.48971 XP_016947991.1.21709 XP_016947992.1.21709 XP_016956757.1.21709 XP_016973252.1.97277 XP_016984659.1.97277 XP_016984660.1.97277 XP_016995927.1.47939 XP_016996254.1.47939 XP_016996255.1.47939 XP_017034734.1.37106 XP_017034735.1.37106 XP_017038600.1.37106 XP_017042067.1.74164 XP_017043849.1.74164 XP_017063146.1.81094 XP_017064008.1.81094 XP_017064009.1.81094 XP_017094606.1.53830 XP_017094607.1.53830 XP_017095504.1.53830 XP_017113196.1.32376 XP_017113197.1.32376 XP_017113198.1.32376 XP_017130341.1.32376 XP_017145391.1.22881 XP_017152552.1.22881 XP_017203252.1.1745 XP_017209248.1.45394 XP_017271631.1.84151 XP_017283849.1.84151 XP_017290848.1.84151 XP_017290849.1.84151 XP_017299181.1.36046 XP_017303499.1.36046 XP_017303505.1.36046 XP_017303507.1.36046 XP_017310133.1.5077 XP_017310134.1.5077 XP_017310135.1.5077 XP_017315073.1.5077 XP_017315074.1.5077 XP_017321860.1.5077 XP_017350842.1.5077 XP_017381928.1.71028 XP_017391266.1.71028 XP_017474382.1.95384 XP_017494520.1.95384 XP_017494968.1.95384 XP_017524722.1.32401 XP_017524723.1.32401 XP_017530303.1.32401 XP_017542144.1.86671 XP_017556303.1.86671 XP_017563054.1.86671 XP_017563055.1.86671 XP_017569369.1.86671 XP_017668379.1.3805 XP_017688489.1.3805 XP_017709841.1.44346 XP_017740187.1.44346 XP_017760616.1.86738 XP_017760617.1.86738 XP_017760618.1.86738 XP_017770925.1.89798 XP_017770926.1.89798 XP_017797793.1.86229 XP_017797795.1.86229 XP_017852587.1.30616 XP_017853815.1.30616 XP_017859728.1.65068 XP_017871499.1.65068 XP_017884545.1.74565 XP_017884546.1.74565 XP_017915713.1.57651 XP_017919285.1.57651 XP_017928796.1.51550 XP_017954131.1.46654 XP_017964172.1.46654 XP_018015766.1.64131 XP_018019358.1.64131 XP_018055106.1.4000 XP_018055114.1.4000 XP_018055126.1.4000 XP_018091870.1.7800 XP_018118148.1.7800 XP_018119714.1.7800 XP_018313040.1.62676 XP_018313048.1.62676 XP_018313062.1.62676 XP_018330255.1.13287 XP_018346731.1.14990 XP_018346732.1.14990 XP_018346733.1.14990 XP_018371440.1.32933 XP_018371441.1.32933 XP_018371442.1.32933 XP_018371443.1.32933 XP_018398174.1.22276 XP_018398176.1.22276 XP_018398177.1.22276 XP_018417049.1.44173 XP_018423862.1.44173 XP_018427137.1.44173 XP_018515714.1.34915 XP_018531544.1.34915 XP_018531545.1.34915 XP_018537306.1.34915 XP_018547157.1.34915 XP_018575034.1.56492 XP_018590542.1.37976 XP_018612713.1.37976 XP_018612722.1.37976 XP_018617125.1.37976 XP_018804829.1.52592 XP_018899168.1.81087 XP_018908821.1.81087 XP_018908822.1.81087 XP_018908823.1.81087 XP_018928637.1.5815 XP_018941213.1.5815 XP_018955939.1.5815 XP_018964753.1.5815 XP_018964754.1.5815 XP_019119054.1.61708 XP_019123407.1.61708 XP_019123408.1.61708 XP_019128305.1.61708 XP_019223220.1.78416 XP_019223221.1.78416 XP_019277539.1.44245 XP_019321740.1.44245 XP_019358909.1.87953 XP_019372086.1.87953 XP_019398137.1.79039 XP_019405100.1.79039 XP_019499967.1.44202 XP_019520692.1.44202 XP_019522680.1.44202 XP_019543073.1.17567 XP_019551983.1.17567 XP_019586467.1.88060 XP_019601181.1.88060 XP_019642898.1.58950 XP_019647944.1.58950 XP_019713282.1.30352 XP_019713284.1.30352 XP_019713285.1.30352 XP_019717114.1.30352 XP_019717115.1.30352 XP_019721182.1.30352 XP_019749340.1.30352 XP_019760311.1.59312 XP_019776084.1.83887 XP_019832208.1.53367 XP_019836582.1.53367 XP_019867859.1.27284 XP_019894871.1.65292 XP_019902611.1.71217 XP_019902621.1.71217 XP_019938801.1.63745 XP_019941394.1.63745 XP_019950586.1.63745 XP_019950587.1.63745 XP_019950588.1.63745 XP_019968301.1.63745 XP_020027103.1.5219 XP_020034399.1.5219 XP_020294911.1.29359 XP_020294912.1.29359 XP_020294913.1.29359 XP_020294914.1.29359 XP_020309008.1.87700 XP_020309301.1.87700 XP_020309302.1.87700 XP_020316080.1.87700 XP_020316081.1.87700 XP_020316082.1.87700 XP_020316406.1.87700 XP_020316407.1.87700 XP_020319415.1.87700 XP_020341358.1.87700 XP_020358558.1.87700 XP_020358559.1.87700 XP_020358560.1.87700 XP_020363421.1.87700 XP_020363422.1.87700 XP_020363423.1.87700 XP_020375176.1.65276 XP_020375177.1.65276 XP_020378092.1.65276 XP_020378559.1.65276 XP_020390937.1.65276 XP_020442093.1.23826 XP_020442107.1.23826 XP_020462018.1.23826 XP_020469143.1.23826 XP_020484967.1.8198 XP_020493283.1.8198 XP_020493285.1.8198 XP_020495792.1.8198 XP_020642249.1.8467 XP_020642250.1.8467 XP_020642251.1.8467 XP_020660735.1.8467 XP_020660737.1.8467 XP_020660738.1.8467 XP_020730067.1.74333 XP_020771264.1.74333 XP_020774912.1.12261 XP_020780089.1.12261 XP_020790268.1.12261 XP_020806054.1.32911 XP_020837803.1.61212 XP_020858323.1.61212 XP_021000498.1.5422 XP_021068124.1.100879 XP_021248269.1.32913 XP_021270265.1.32913 XP_021346644.1.56386 XP_021397342.1.53032 XP_021398988.1.53032 XP_021401352.1.53032 XP_021420357.1.32639 XP_021420842.1.32639 XP_021420843.1.32639 XP_021431291.1.32639 XP_021431292.1.32639 XP_021437834.1.32639 XP_021437835.1.32639 XP_021437836.1.32639 XP_021437837.1.32639 XP_021443319.1.32639 XP_021443320.1.32639 XP_021443321.1.32639 XP_021473411.1.32639 XP_021479547.1.32639 XP_021491502.1.76796 XP_021497522.1.76796 XP_021511235.1.76796 XP_021535182.1.83697 XP_021547325.1.83697 XP_021547352.1.83697 XP_021547389.1.83697 XP_021547421.1.83697 XP_021547466.1.83697 XP_021547503.1.83697 XP_021952400.1.6718 XP_021952401.1.6718 XP_022046566.1.10920 XP_022057185.1.10920 XP_022060257.1.10920 XP_321242.1.40869 XP_537232.1.84170 XP_624499.1.77095 XP_858804.1.84170 ENSMEUP00000003719 AC03729-PA AC03731-PA ENSBTAP00000034086 ENSBTAP00000034581 ENSCSAVP00000007468 ENSCSAVP00000015809 OVOC5143 OVOC8216 HMEL000014-PA ENSTRUP00000011674 ENSTRUP00000011743 ENSTRUP00000015496 ENSTRUP00000017612 ENSTRUP00000039814 KNC22383 ENSSTOP00000022060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]