SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_021826510.1.100051 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_021826510.1.100051
Domain Number 1 Region: 75-109
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 0.00000000811
Family Cyanase C-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_021826510.1.100051
Sequence length 119
Comment uncharacterized protein LOC110767311 isoform X2 [Prunus avium]; AA=GCF_002207925.1; RF=representative genome; TAX=42229; STAX=42229; NAME=Prunus avium; cultivar=Satonishiki; AL=Scaffold; RT=Major
Sequence
MLWVSHCINCSGNNGILVRMHGHEFGKASGMGSLLLCVGLNYFLGGTSRNYRYNLCDLFW
VFVSLTAHSCFTYSMSAIDFYYLVDKVKGVDGKDRVALVFDGKYLPHSKQDDGVDFNCA
Download sequence
Identical sequences XP_021826510.1.100051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]