SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_022072699.1.10920 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_022072699.1.10920
Domain Number 1 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-55
Family YWTD domain 0.00000412
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 9.29e-54
Family YWTD domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 332-567
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-52
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 4 Region: 936-1197
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000389
Further Details:      
 
Domain Number 5 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 7 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000374
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1288-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 589-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 287-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000205
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 1205-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000525
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_022072699.1.10920
Sequence length 1495
Comment low-density lipoprotein receptor-related protein 6 isoform X2 [Acanthochromis polyacanthus]; AA=GCF_002109545.1; RF=representative genome; TAX=80966; STAX=80966; NAME=Acanthochromis polyacanthus; ecotype=Palm Islands; AL=Scaffold; RT=Major
Sequence
MGVALRSLLLCTFCFLVRGEPLLLYANRRDLRIVDAAHEKSNATVVVGGLEDAAAVDYVF
SQGLIYWSDVSEEAIKRTFFNQSGGGAVQTVVPGLASPDGLACDWLGRKLYWTDSETNRI
EVSELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNRSMIIDK
EIYWPNGLTLDYGQQKLYWADAKHNFIHRCNLDGTSREVVVKGELPHPFALTLYEDTLFW
TDWNTHSIHSCRKQTGAEQRVVHSDIFSPMDIHVFSTKRQPDLSSSCSLNNGGCSHLCLL
SPVKPFHQCACPTGVQLLEDGRTCRDGATQMLLLARRTDLRRISLDTPDFTDIILQVDDI
RHAIAIDYDPVEGYIYWTDDDVKAIRRSLLDGSDAQFVVTSQVNHPDGIAVDWIARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDGM
ERVVMVNTSLGWPNGLALDYDQRKIYWGDAKTDKIEVMNMDGLGRRVLVEDKLPHIFGFT
LLGDYIYWTDWQRRSIERVHKRSAEREFIIDQLPDLMGLKATYVHKTFGTNPCAENNGGC
SHLCLYKPQGVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLT
GVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAMD
GTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQDREVIADDLPHPFGLT
QYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGWNACASTNGH
CSHLCLAVPVSSFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKMAINRMVIDEQQSPDIIL
PIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSMTVVSSSLSGPNQGLQLYDL
SIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLLER
SPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRIVI
ADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSDIHAVHELDM
REYGKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLPDELSCGEPPTCSPEQFSCTSG
EVDCIPQAWRCDGYPECDDSSDEEDCPVCSESEFQCDSRQCIDLSLRCNGEINCQDRSDE
NKCEVRCPADQFTCSNGQCVGKHKKCDHNMDCTDNSDEIGCYPTEEPPQPPNNTISSIVG
VVMALFVVGAIYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHPSSLSSSLPGM
SRGKSVIGSFSIMGGSGGPPYDRAHVTGASSSSSSSTKGTYFPPVRNHHRPSVEV
Download sequence
Identical sequences XP_022072699.1.10920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]