SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_022080240.1.58406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_022080240.1.58406
Domain Number 1 Region: 1616-1858
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000353
Family Tropomyosin 0.00059
Further Details:      
 
Domain Number 2 Region: 1289-1522
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000349
Family Tropomyosin 0.002
Further Details:      
 
Domain Number 3 Region: 748-977
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000379
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_022080240.1.58406
Sequence length 2294
Comment early endosome antigen 1-like isoform X2 [Acanthaster planci]; AA=GCF_001949145.1; RF=representative genome; TAX=133434; STAX=133434; NAME=Acanthaster planci; AL=Scaffold; RT=Major
Sequence
MAEFSYGRSGSMHRTRAERPLTDSNFGMKHSTSTPVIRAASPAGRGLYGSSSRASNVSST
GSESMQGLMNEFRELYNSRLEKLEAEDDGHEETAKKKLRILQSYINDLTEQNDVLLKTVE
DLEREANERVASLEGKLQEAQTTIKENSIKSREAEHEMRLVNIQKQNTEQTLHDLQHRFD
RQREENEALRDENADLNHDLNILIGLIGQSRATGKWELGRLDALRLVSRDQILGPNPQDI
PTTDAIMQGHIEDLKAQLRHRDNLILKLQSDLKGSRDNQMSSADEIARRGMVLDSTKTTL
STIHDREQQRMVSETDKDITIMKLRSTLHQAEQNRQDAVQEMAGKEQNIDQFRSLVNELQ
NELVVRESEKVSHIQTIALLKEKQRQSFDQVAHLEQRIKNLEVELRQSHDQRRKTIDEIG
VLQSRLRDKQLSSQDSHQLLKQELSRRDDTIQQLRKEVLNLQEHHDNTLSELQKSEEEMR
NLEGDLAEVSRQLQGALEEASMKECTIKELHQDLSQSQGQCNELRAQVEKLCRQVATLSN
ASRDTQNALTEEVAERHDTIVHLRSDLQLLEEQHQECLAQVQHRGEIMQQLRQDLKKANT
ELAEVQEQASRTEEEARQRAAKLQADLTVKEGALQATRTELTNVQEKVSKSQSQVENREE
TIQRLQRQVRTLQGESERREDAVRKLEAEQTASQEEKRKLVEELARRKTSLSQMDSELKK
TKQQLQDTMEENGRLAARIQAAQITAQSEHDVLNIEVSRRDEAMKRMKNEQTALREQVAK
SEEKLSKQEMALEQLRHQCKKAQNEIKSRNETIQSLERQIQEMRHMHSGARDEVERLEQA
LQELNSEFQSTQIKEESLQQNVKMKEDVISELKADAETLHEQHKEFLAKIAERDGALQKL
NNENAKLKTRSQEKTAEIQRQTNMMKRLEDSITKAQLDMEELRRKHQDEMARRDESLGQM
REELMEAQQQYTTCYDEVIKLEDLLDRVRAENAKLQKQGEHDAGELLALAEQAQRLELDL
AVVQEKHRTCQKEVAARDQTVLRLQAELDTTQQQYQGSLEELAAHEEDLQEARAKVKSLQ
GEIRDLRDELAQRERKVASDEKFIHQLQEQCQTSRMESQTHLAEIGKQQTSLQAAKQLHA
EDVRSFTAQVNDLKHELEEGRAQLDKSELQGLQHKSAADGLTADLEKTQQLHKSAMDRIV
QLNRSLEERKESYSRARQDVAKLQDQLEQVQYTTQEVNTELASYKERHGQALEQLQRAES
SSAATIRGLEKQIGECQNKIKDKDDTADKLRRSLNDLELQLNDKTDHVQKAERVIDSLTK
ELDKTQGELKATKEKLENSEDNIENLKDKLLEKQQQSAQYQEQAHKLQADLKSYREEHRH
TVQEVSERDEAAQQLQLHLRQLESALAGKERDTADLRIRLEEATFDLEGTRRQLEDTKKE
IQGLEEVVKQQQLDLASASQKHKTEVLKLEDQVKQLESSLSEAKKALKTLSQEIERKKES
LQKKDNEISLSKESIKIKVEEIGKLETTVRSLNDEIQQLQGRERQAHNDNAKLQGEGRQL
KEDLTEARQQYRDAAQELAHHEEKLLLMESSLQSTQEQLSQRVTETVRHEQLNRRLQAEL
RTARDQVQLLEEEAEDQQGMAEALQRELASSREELEGARKELERWKGEGEKLEGKVGDVE
EQLVALQEQMSEQGSELQDQREELEAERQRYSDASRQLQDYKLRLGELEDEMAGCRSQIK
DKDAQIFEKDNHMATLEQEHTSLQSKLRSLREDLTEREGQLHVVRLNLETSETQNRRHAQ
SVAHYEESLAQLQADLEKSQEEYRSAHAELVESQQQIRDMRVQLSEVQGQHKEAMNQLGE
RATLAAKLQSELSRADKQNHALSEEVGMYEDKMRKLRGELKKVQDLNHQSQQEVQNYEAH
VEQLADKLRHAEEKQRLSVQEVAMREEQIVVLKVEVASLQEKLRHRIEESDKLVKEVNEA
TQKHIDVCKENDRLRTSLEEARANGDRLHSESELVVSNVNSWVQSQKEANEKLGAKIKEQ
NQTIRTLNKEKDQLLESGEVLQQTVSRLKLENEDLRVAAERFKALQSHSSHQQMLLQQLK
SRLEDHETDQEQEISEKLATIEDLHGRLKANVATIQQLNEQLHALKQETVRQRSDIEKER
AARQNLRMQLDSREQAFSALKAQMESERYQWTVNGTVPRHGGETYTDGVVSESTYPSGLG
RGSQRQSREKMQSAINSALKDAGVSDPNALDKSYWVQRVGELSLQLQQSSEFWSEKVRDL
SSQLQRSQSPSPHK
Download sequence
Identical sequences XP_022080240.1.58406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]