SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_022106372.1.58406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_022106372.1.58406
Domain Number 1 Region: 641-896
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-53
Family YWTD domain 0.00000619
Further Details:      
 
Domain Number 2 Region: 340-579
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-52
Family YWTD domain 0.0000029
Further Details:      
 
Domain Number 3 Region: 24-288
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-50
Family YWTD domain 0.00000171
Further Details:      
 
Domain Number 4 Region: 949-1208
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-36
Family YWTD domain 0.0000983
Further Details:      
 
Domain Number 5 Region: 596-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000032
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 6 Region: 1297-1333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 898-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family EGF-type module 0.015
Further Details:      
 
Domain Number 8 Region: 1257-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 9 Region: 295-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000726
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 10 Region: 1215-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000089
Family EGF-type module 0.019
Further Details:      
 
Domain Number 11 Region: 1335-1372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_022106372.1.58406
Sequence length 1647
Comment low-density lipoprotein receptor-related protein 6-like [Acanthaster planci]; AA=GCF_001949145.1; RF=representative genome; TAX=133434; STAX=133434; NAME=Acanthaster planci; AL=Scaffold; RT=Major
Sequence
MAWLWILVLVCCLRAQIRALPPELVFANRKDIRILNFGMSNDSDVATTESSIIIGNLEDA
AAMDYLFSEQLIFWTDVSIEMIKRMRYNGSQIQEDVISTDVKAPDGLACDWVGRKIYWTN
TETNRIEVSELNGQSRKVLYWQDLDQPRAIVVHPERGLLFWTDWGEIPKIERAGMDGSEH
YRKVIIDTNIFWPNGLTLDYDTSKLYWADAKYSYIHRCNFDGGNREQVLQGSLPHPFALT
LFEDTLYWTDWETHSIHACNKMDGGNLRVVHEDLFSPMDIHSYSPLRQKEVSRLCAVNNG
GCSHLCLMSPDPPFYACACPTGVRLQSDRLTCANGAQEILILARRRDIRKISLDTPDYTD
IIVPLEDIQHAVAIDYDPVEGFIYWTDNDVKAIRRAKLDGSASEYIVTSDIDHSEGIAID
WIARNLYWTVTGTDRIEVSRLNGTSRKVLISEGLDEPRAIAVDPMAGLIYWSDWGEIPKI
EKANLDGTGRSVLINTSISWPNGIAIDHQEGKIYWGDGKEDRIEVVDMDGSNRRVLVDNE
IPHIFGFSLLGDYIYWTDWQRRTIERVNKHSGEDRQMIMETSDVMGLTASSVREVQGHNP
CGTNNGGCSHLCFYLPPSIICSCPIGYELLADQRTCIIPEAFLLFSLASDIRRISLETNH
NDVEIPLTGVKEAGALDFDINDNRIYWSDMDAKTISRAFLNGSGIENVIEFGLSFPEGMA
IDWVAHNIYFSDTGTDRIEVARLDGSARRVLVWERVQSPRSIALHPSEGYMYWSDFSGQA
QIERAYMDGTHRSVIYRGGRANGLTIDYLERRLYWTSLDTNTIESADLLGGSRRRVIPDD
LPHPFGLTQYQDYIYWADWETQSIERANKTNGLNRTLIQDGLEYVLDILVFHSSRQSGWN
ECAVNNGGCQFLCLSHPNVTTGEWDYVCQCPTHYTLNEDGQTCTPPDRFLLFSQKNTISR
MAVDYRNSPDVVLPIYNSRKNIRAIEYDAQEKRVYWINTRANTVRRSYDNGVQPEVFIPN
SGDPPVYNPYDLAIDPYTRMMFWTCSETNTIRITRLDGTPIGVVKGDDNQKPRAIALIPE
KGLMFWTNVVRTQHKIERASYDGTEHTVLFSVNLGELGPITADPSSETLFWVDTMLKRIE
SAHISGSDRRTLVEDHILLPKGLAVLGDHLYWVDRQAEIIARVNKYSGSGWVRIQGETSY
LTDIQAVGMPLQADHPCIDDNGGCSHICIAMGDGQSRCSCPLDLVLQEDESTCGDPPTCS
TKEFTCVSDSNLCVPLSWRCDSDFDCDDHSDEEDCPFCKPNEFRCDNGQCIDMVLRCNSK
NDCSDDSDEQYCTAPCRANQYECVNKQCVDVENPTCDGVRHCYDGSDEKNCDENPQETPT
INKPPEMSGAVIGSIVALIFVIFIIIGLIIIFRHCRCGTAQGGMAGRGAVDNGQYSTVLM
VNQLGGRDSSSKYLSGSARCSNLKSTNLHSCANGKSGSSSSCGGLFERAHPTGASSCSSE
MSVSGNSNYPKETLNPPPSPVTDRSQCMADLYYPPQNPSTSRSYRHYKMRNIPPPPTPCS
TDFCEDSEPYVKTPHHQKHHATRRKRGNKYYTNVTNFDVAYEPEPYPPPPTPIMSDNNYE
SCPPSPSTERSFFNPYPPPPSPATDST
Download sequence
Identical sequences XP_022106372.1.58406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]