SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_309938.3.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_309938.3.40869
Domain Number 1 Region: 10-133
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.15e-35
Family Insect phospholipase A2 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_309938.3.40869
Sequence length 137
Comment AGAP011569-PA, partial [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
HKRAISDWFLSPNTKWCGKGHSASEYRQLGGASRADMCCRTHDHCKYMIPPMSTNFQTFN
IRPFTISHCACDSRFRTCLKLADSKDANLVGKLFFNVMQMKCFVFKPETVCTKKSWWGTC
ERKGRRKRAVLRHNRKF
Download sequence
Identical sequences Q7QGJ7
AGAP011569-PA|hypothetical AGAP011569-PA 7165.AGAP011569-PA XP_309938.3.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]