SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_530409.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_530409.2.37143
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-22
Family Kringle modules 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_530409.2.37143
Sequence length 263
Comment PREDICTED: phosphoinositide-3-kinase-interacting protein 1 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASTP
VSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPEATSQALPAFTTEIQEAS
EGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDPQEGSTPLMGQAGTPGA
Download sequence
Identical sequences H2QLI4
ENSPTRP00000024575 9598.ENSPTRP00000024575 ENSPTRP00000024575 XP_530409.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]