SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_570171.1.95466 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_570171.1.95466
Domain Number 1 Region: 316-380
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000825
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 2 Region: 221-242
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000602
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_570171.1.95466
Sequence length 598
Comment mRNA polyadenylation-related protein [Cryptococcus neoformans var. neoformans JEC21]; AA=GCF_000091045.1; RF=representative genome; TAX=214684; STAX=5207; NAME=Cryptococcus neoformans var. neoformans JEC21; strain=JEC21; AL=Chromosome; RT=Major
Sequence
MSTVFYRWGAGRDESRVTFDGTHISVFDLKREIILNNKMGNGKDFDLSIYDNVTGEELKD
DNQQIPRSSSLVARRLPPSLGKGRGSAADYIAGTTAAEALTGDHRVESHARQAMLDKNLT
KGIRSAGGTYGSLSKRFDGKEEKPAEKVQVSTGDKDEDAKIQAILAQGAETWEQMQEDMS
AGYRAPAARAARANKPSGSAVAGASQKYDFSLGPEKEPPVGYICYRCGQKGHWIQNCPEN
DDPAAAERKRFVRVTGIPRSFLKTVETPVGAEGSSGGAMLTADGGFVKAVPDQRQWQKQA
AVKPRALTGADVRDQEPLEADLTCPLCKKLVWEAVRTPCCNTAFCEECVQTYLVDHDFEC
PHCESKVPSLDRLKPDEDLRKRSRNYVDHELQKNKDAKGDSADGDVKEEAENDKNADDSE
EGSLTPKEQNKNQILGADGQPLNSDLLDPHMIQNYLFGAKKMLLNPDLNPAARALLTTQM
QTLQANLLQMQMMAMMNGMGMGVGLPLMGGQNNVGGGQTGIGLNGAIDNSMAMRGRPGFR
GGFRGRGMATGQGFQRGPLGPAAQGGMGMGMMNRPNVPAKRGADVELGGEAKQPRTGV
Download sequence
Identical sequences F5HC56 Q5KID1
sgtc|cn04300 214684.CND03400 163.m06283 XP_570171.1.95466 XP_775887.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]