SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_571019.1.95466 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_571019.1.95466
Domain Number 1 Region: 30-226
Classification Level Classification E-value
Superfamily Ribosomal protein L1 4.06e-62
Family Ribosomal protein L1 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_571019.1.95466
Sequence length 226
Comment 60s ribosomal protein l1-a (l10a) [Cryptococcus neoformans var. neoformans JEC21]; AA=GCF_000091045.1; RF=representative genome; TAX=214684; STAX=5207; NAME=Cryptococcus neoformans var. neoformans JEC21; strain=JEC21; AL=Chromosome; RT=Major
Sequence
MSKLQASSVRGSIRTVLDQSSLETHKEAGGKKRNFVETIELQIGLKNYDPQRDKRFSGTV
KLPHVPRPRMSLCILADAMDVDRAKQLDEELPFMTVEDLKKLNKNKKLVKKLAQKYDAFL
ASEALIKQIPRLLGPGLSKAGKFPTPVSHSEDLARKINDVRSTIKFQLKKVLCLGVAIGH
VDMTEDQVMQNVMLAINFLISLLKKQWQNIQSLTIKSTMGKPQRLF
Download sequence
Identical sequences F5HHI9 Q5KGE3
214684.CNE03920 XP_571019.1.95466 XP_775117.1.65578 167.m03537 sgtc|cn05396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]