SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_652054.1.49425 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_652054.1.49425
Domain Number 1 Region: 145-252
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.00021
Further Details:      
 
Weak hits

Sequence:  XP_652054.1.49425
Domain Number - Region: 261-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00977
Family Retrovirus zinc finger-like domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_652054.1.49425
Sequence length 309
Comment RNA-binding protein [Entamoeba histolytica HM-1:IMSS]; AA=GCF_000208925.1; RF=representative genome; TAX=294381; STAX=5759; NAME=Entamoeba histolytica HM-1:IMSS; strain=HM-1:IMSS; AL=Scaffold; RT=Major
Sequence
MEEVKEVDYKERFTHPGGLPIHEKRVSRWDRKIRDVLPNIPVHIPPSLDEKYWDTLAIRI
RYEELQYALGTHRLGLNTERDRTPSPPKQYNENQQEITREMRREEKLKNERLYVVDRAIE
IYPSFRIPAELAKPSGKRTKKIYFPKDRPDTNFIGLIIGPRGDNQKRLEKDSGAKISIRG
KDPKKLGKLSGYGDKDNEDSHVFITADTQEALDLACEEITKIISAPSEEINVLKHNQLRE
LALWNGTFREDRVYEVEQYESGVKCGFCGDSSHATCDCPLKKQKMSEHQLELERAFDEFM
EKIQLQLIN
Download sequence
Identical sequences A0A175JSG8 C4M4V3 M2S1C8 M3TMP3 M7X0L3 N9TDJ1
jCVI|EHI_193510 294381.C4M4V3 XP_652054.1.49425 gi|56468858|gb|EAL46666.1| gi|67472501|ref|XP_652054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]