SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_661082.1.1458 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_661082.1.1458
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000385
Family Centromere-binding 0.034
Further Details:      
 
Weak hits

Sequence:  XP_661082.1.1458
Domain Number - Region: 529-554
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.017
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_661082.1.1458
Sequence length 554
Comment hypothetical protein AN3478.2 [Aspergillus nidulans FGSC A4]; AA=GCF_000149205.1; RF=representative genome; TAX=227321; STAX=162425; NAME=Aspergillus nidulans FGSC A4; strain=FGSC A4; AL=Scaffold; RT=Major
Sequence
MPRVRVSSSQNCHEKEGRLLLAVQAIKKKEITSIREAARRFNVPESTLRTRLRGTTNRAE
SRANGHKLTEIEEEVLKQWILSLDLRGAAPTKAHVREMANILLAKRGSTPIQTVGQKWVY
NYTQRHPELESRLSRQYDCQRAKQENPKVIQAWFNTVRATIEQYGILPDDIYNFDETGFA
MGLCAHQKVITKSESCGRRPVLQPGNREWVTAIESISASGWALPPTLIFKGKQYNQAWFT
GLPPDWRFEISTNGWTTNEISLRWLQKQFIPSTEHRTRGRYQLLVLNSHGSHLTPEFDQI
CTDHNIIPLCMPAHSSHLLQPLDIGCFAVLKRSYASLVDQKMRLGISHIDKLDFLAAYPQ
ARISTFKLDTIRNSFRAAGLVPLNPEPVLSKLSIQARTPTPPGSRGSQASTFCPHTPANV
DELLKQASLLRDFLKQRSKSPPSPSHNALNQLIKGCQIAMQKGILLEQENRALRAENAIQ
RRKRARTHRWIAHDNGLSVQEATELEEAHNASFQAIPGPCGPPAEGAQTPKARALPTCST
CHRIGHRRNACPNK
Download sequence
Identical sequences A0A1U8QGC9 Q5B7K2
162425.CADANIAP00005279 XP_661082.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]