SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_699097.4.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_699097.4.45394
Domain Number 1 Region: 675-799
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-39
Family Regulator of G-protein signaling, RGS 0.0000932
Further Details:      
 
Domain Number 2 Region: 989-1085
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-27
Family Ras-binding domain, RBD 0.0011
Further Details:      
 
Domain Number 3 Region: 8-94
Classification Level Classification E-value
Superfamily PDZ domain-like 1.73e-18
Family PDZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 211-338
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000393
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 
Domain Number 5 Region: 935-1003
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000196
Family UBX domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_699097.4.45394
Sequence length 1371
Comment regulator of G-protein signaling 12 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MRLLDRPISPAVRRVEMERGRAGYGFTIAGQAPCVLRGIIKGSPAHSVGLLPGDRVLRVN
DTDVSEASHDVVVKLIGTSSKSLCLLVTSGDRPPMACCSSDEELGCQNKSKRPWLNPGIK
DPFPGKLDGRDLKEPILQSVGSFDTVFEISDQGTMTPHQEKQKKQRPLSEPDVSYWLQQQ
QRSKGNVDILSQDETSRVVSEDSVFSDLQSQNDLASDSSILNVAMIVGYINSMELELVMS
QTEEDALQVIRQCISKIGIEQKTHSLVLMKVKCNCVQLCDDRDVVLASYPAENLALCVIC
TEDSRFFGLVSIDSTKNIDTGRQTSTLKTLCHVFFIDPELYEHKEHQSIIGHFGIPCTPD
PDTQSCLEFPQTPHSISHFISVLYADMGDYIEKLRLKLDSENPDEGSQNARNSGSGSGSD
SGIGNASPEERDSLIGQWSFTSPNICNPPPPYYSQHRNSTFLKPECRCLLSEPLTGSAQP
ATPSGVPAGADGSAFTPVPLSKQSNLPPKQRAGQRRPSIGLKARWQKSRPNSIECLVEGD
NDDPKSKCSTLPPAMEQIPTLRYKPLEHTQRINFTPQLELTSRFFSSAAKQKDGENKGSL
FWALTRGRSSVRRPSGPAKRLSLAHSLNDLESAASDGERSGGGVQRHDCSSVSSLDSNGS
LPSVTNHCRFTERRVALWAVSFERLLQDPVGVRYFSEFLKKEFSEENILFWQACECFSQV
PEHDKKQLSQKAKEIYNRFLSSKATMPVNIDSQAQLADDVLTAPQPNMFKQPQLQIFNLM
KMDSYARFLKSTLYQECMLAEVEGRPLPDPCPIPCSPAPSKHSFTSDRSTFSTPKKENRK
PKTGRSSDDLREKHSDKKNGFFSWYRYPSIGKGQKKREAPDLPYHCNGRRESQGSLSSGA
SQELNTSCSGGKNEQCELRGSSCALDKERERCSRTCTVTLPDGSSCSIPLRQGASIRQVL
LELCQKQHINLAAVDLFLTGGEKPLVLDQDSITLSSRELRLEKRTLFRLDLVPINRSVGL
KAKPTKPVTEVLRPVVAKYGLQLGDLVARISGETEVLDLGVPISNLDGLRVVLERADPAK
AEKSKTLNSKTPAAKKGFPRERDDNSTVKPLKADVEDKHPRTAASERKKGKKNHIDETEE
FFELLSRAQSSRVDDQRGLLRKEDLVLPDFLRVNPDPKPQSPPSCSTPTSHKPGHTTTTS
TNPHPPKPSPCNGHQASAPFSAPLSPILRSAGAREQEEEEGLGDLTLVAEGDISSPNSTL
LPPPPPVSPPPYDGSLAEANFTPPPAVHGTGTEEENTSTSAVNSSTAQPDLRVRDKGVTL
EDSFEGYAAELRQCQNKMRNGVYPSTEAPRPLSGVLEVNESDTVQYKATFV
Download sequence
Identical sequences F1QV08
XP_699097.4.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]