SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_717926.2.88832 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_717926.2.88832
Domain Number 1 Region: 4-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.11e-71
Family Capz alpha-1 subunit 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_717926.2.88832
Sequence length 280
Comment hypothetical protein CAALFM_CR01180WA [Candida albicans SC5314]; AA=GCF_000182965.3; RF=representative genome; TAX=237561; STAX=5476; NAME=Candida albicans SC5314; strain=SC5314; AL=Chromosome; RT=Major
Sequence
MSINLNELVDSLIQSAPPAELKQVSQSLSSLTKGTSTSSTNSLIQDSIEQYAQENIISID
NIIISKYNKDENSSKYIDYVNNKLFNVDWQNQKIIDVESYHDNNNKRGSNYDELIQKLSQ
YGDDYYPSNFAFTVIPESEDQLRVIIIGQRANHDNFYTGQWKSNYLITEQGIKGNIDLDI
HYFEDGNVRLKFNESINSSNNNNNSSTLQSGNLINNASRIVNFINEQENATMVKIIEQFN
NLNQKSFKNLRRLLPVTRSKINWGSAIGNYRLGSDVINKK
Download sequence
Identical sequences Q5A893
XP_717926.2.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]