SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_735062.2.12432 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_735062.2.12432
Domain Number 1 Region: 141-520
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.23e-92
Family Cystathionine synthase-like 0.000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_735062.2.12432
Sequence length 546
Comment cysteine desulfurase, putative [Plasmodium chabaudi chabaudi]; AA=GCF_900002335.2; RF=representative genome; TAX=31271; STAX=5825; NAME=Plasmodium chabaudi chabaudi; strain=AS; AL=Chromosome; RT=Minor
Sequence
MKVFKIAKTLNPQSSNIFNKLNKCSETACFKNNLKHNYTSVVNSNENVFNKNGCHNHRKF
NSKADNDEVTTEGEGNEIKMKIPKSSENLKNDTPNDNLDILNTINNALNDQKNNDNFNKL
NKKIELIANFMSKEKEKKMNRFYLDSQATTMIDPRVLDKMMPYMTYIYGNAHSRNHFFGW
ESEQAVEDARANIIKLLNGTNNKEIIFTSGATESNNLALIGTCTYYNKLNNKKNHIITSQ
IEHKCILQTCRYLQTKGFEVTYLKPDTNGLIKLEDFKNCIKENTILASFIYVNNEIGVIQ
DIENIGKICKENNIIFHTDASQAVGKIQIDVQKMNIDLLSLSSHKLYGPKGVGALYIKRK
KPNIRLNAIIHGGGQERGLRSGTLPTHLVVGLGEAANICLSEMDRDNQKMHFFFNYVKNY
ISKNLDYIVFNGCQTNRYFGNMNISFLFVEGESLLMSLNDIALSSGSACTSSTLEPSYVL
RSIGITEEIAHTSIRIGFNRFTTFFEVQQLCNNLVKSVKRLRSISPLYEAELEKNTSGDY
PKFIWT
Download sequence
Identical sequences A0A077TIK6
XP_735062.2.12432 PCAS_020970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]