SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_744357.2.12432 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_744357.2.12432
Domain Number 1 Region: 13-483
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.49e-77
Family GABA-aminotransferase-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_744357.2.12432
Sequence length 484
Comment serine hydroxymethyltransferase, putative [Plasmodium chabaudi chabaudi]; AA=GCF_900002335.2; RF=representative genome; TAX=31271; STAX=5825; NAME=Plasmodium chabaudi chabaudi; strain=AS; AL=Chromosome; RT=Minor
Sequence
MKIVKELCKKGKVKWRRYISSQSLQNYNSLKNVDEDNYNILSTYKNKSYLNLSVCNNVIP
KYVHDCLVNNLNKNVTLNLEHLKIIEDRALAAFNLENKYWGCVFNTSSHSECTNSMDEYF
LLKLFRNFVNYQSKIMIISFTLLDKETHEENNKEENRTDKNVLNEFYNILYIKNNDKINY
MEIKNQYEQFKPDLIYIDETNNPYNFDYEFITTLRNMKSKINNNVNSEKEGVEDKSNTLV
MTNISNKASFIIEKFISSPFSQADIVFSYLNENIRANNCYIIFYRKGFKNISTQGKLICY
EYEEKLKKTFFQNNVNNIICSLSTSFKCIQNHEFKEYIHQINKNINVLFSYLNKKYFNIH
FDQNNNFLNIACSNSLFNIQEYHMFCKKINILFDIININKSIYPQKSFNIGTNYLTALGM
EEHDMKYVSEFINQSILLYLYTKQKSANSNLTFLEYLENNFISSDILALSNDIHSFVSMF
PSPS
Download sequence
Identical sequences A0A077TQS9
XP_744357.2.12432 PCAS_132310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]