SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_750311.1.65241 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_750311.1.65241
Domain Number 1 Region: 367-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.21e-41
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 300-374
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.03e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.014
Further Details:      
 
Domain Number 3 Region: 104-254
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000131
Family B3/B4 domain of PheRS, PheT 0.014
Further Details:      
 
Domain Number 4 Region: 4-77
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000229
Family Domains B1 and B5 of PheRS-beta, PheT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_750311.1.65241
Sequence length 600
Comment phenylalanyl-tRNA synthetase, beta subunit [Aspergillus fumigatus Af293]; AA=GCF_000002655.1; RF=representative genome; TAX=330879; STAX=746128; NAME=Aspergillus fumigatus Af293; strain=Af293; AL=Chromosome; RT=Major
Sequence
MPTISVDKAALFKELGREYTTEEFDELCFEFGIELDEDTTNSDRPIVDGKQEPPQLKIEI
PANRYDLLCFEGIQLMLNIFLGRKPLPNYRLVEPANGQLEKIIVKEDTMKVRPLVSGAIL
RNIKFDKARYESFIALQDKLHQNLARQRTLVSIGTHDLDTIQGPFTYEALPPKDIKFVPL
NQTKELNGEELMSFYEKDKHLGKYLHIIRDSPVYPVIYDSKRTVCSLPPIINGDHSKITL
DTKNVLIEITALDKTKLDIVTKIMVTMFSQYTSKPFTVEPVQIVSEHNNETRVEPDIAPR
TTQAEVSYINQCCGLELSPEEICKLLTKMAYQARPSASSPDLIDVDVPPTRADVLHQADI
MEDVAIAYGFNSLPRSFPSKSGTIAQPLPINKLSDIVRMEAAMAGWTEVLPLILCSHDEN
FAWLNRKDDGTTAVKLANPKTVEFQVVRTSLLPGLLKTIRENKHHAVPIKIFECSDVAFK
DLTLERKSRNERHFAAAWYGRTSGFEVVHGLLDRIMAMLKSAFITGEECLENPAVNDSHY
WIEELDEPTYFPGHAASIHLRIAGKDHVIGAFGILHPTVLEKYELKYPVSTLEINIEAFL
Download sequence
Identical sequences B0XP54 Q4WJK9
Afum_A1163:AFUB_005990.t1 5085.CADAFUAP00009272 Afu1g05620 XP_750311.1.65241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]