SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_752312.1.65241 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_752312.1.65241
Domain Number 1 Region: 21-109,198-432
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.31e-76
Family IF2B-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_752312.1.65241
Sequence length 439
Comment translation regulator GCD7 [Aspergillus fumigatus Af293]; AA=GCF_000002655.1; RF=representative genome; TAX=330879; STAX=746128; NAME=Aspergillus fumigatus Af293; strain=Af293; AL=Chromosome; RT=Major
Sequence
MPTTSAALTPGLASFLKSLKTTPIDTSIDNLISLLKRRQIRHSRSCATATAYLLLRVVSA
CRTTDAAKLIERVQSVGRRLVAAQPREMVVGNIVRRVLGLIRDEAEDERDGDFTLSDAGS
EGQPQTPRVSEDPSDPLSLRHEGSERSSSRPPFTSLATTPISMFNLLSHPEPETSLPGTP
ASASPSGRLLGHAPTRDIRAEVLDGIGEIIDELGQVDDQIAAYALDHIHSNEIILTHTSS
TTVQKFLLKAAAKRKFTVIHAESYPNNHEATHTTVSGAASTDEEILSTDSFQKPLIALGI
TVILIPDSAVFALMSRVNKVILGTHSVLANGGLVAAAGTRVIARAAKVHQTPVVVVSGVY
KLSPVYPFDFESLIEYGDASKVIPYEDGDLMDQVDVQNPLYDYVPPELVDLYITNLGGHA
PSYLYRIVSDHYRKEDINF
Download sequence
Identical sequences A0A229XSW1 B0XQ67 Q4WTF8
XP_752312.1.65241 Afu1g09450 5085.CADAFUAP00007579 Afum_A1163:AFUB_008900.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]