SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_774843.1.65578 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_774843.1.65578
Domain Number 1 Region: 56-262
Classification Level Classification E-value
Superfamily Ribosomal protein L1 3.01e-38
Family Ribosomal protein L1 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_774843.1.65578
Sequence length 358
Comment hypothetical protein CNBF0080 [Cryptococcus neoformans var. neoformans B-3501A]; AA=GCF_000149385.1; RF=na; TAX=283643; STAX=5207; NAME=Cryptococcus neoformans var. neoformans B-3501A; strain=B-3501A; AL=Chromosome; RT=Major
Sequence
MAPSSALPATSKKAKKPQPTPKAPLPLPSTFSTAQAEKAVKALLAHHAKVSKQKEEEQLL
PREEHVWVVVNTKTGSTRRSLNPVKIQLPHPALPPPPTSSVCLFTKDPQRQYKDLLAQHN
IKFISRVVGVEKLKGKFKPYEARRELLRDHDMFLCDERVLGVMPKLLGKMFFEAKKQPIP
VNLQRKDLTSTLARAISSTYFHPTTGTSTSTRIATPSHSSTSQTLANLLEAVPQIVAEVD
GGWEGVLSVGIKTSGSVMLPVWTGKLGGRFEKAEKPEKSANSGEEMEVEVEEKSETPSAP
APTVEKREKKEKAAAAPVEKPKKKSSTIGSTAGGAAKRAKQVAVGAKKPAVKKSKSKL
Download sequence
Identical sequences Q55RI3
XP_774843.1.65578 sgtc|cn06008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]