SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001034862.1.98618 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001034862.1.98618
Domain Number 1 Region: 139-432
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.58e-127
Family Enolase 0.000000000103
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.54e-58
Family Enolase N-terminal domain-like 0.000000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YP_001034862.1.98618
Sequence length 434
Comment phosphopyruvate hydratase [Streptococcus sanguinis SK36]; AA=GCF_000014205.1; RF=reference genome; TAX=388919; STAX=1305; NAME=Streptococcus sanguinis SK36; strain=SK36; AL=Complete Genome; RT=Major
Sequence
MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKSRYG
GLGTQKAVDNVNNVIAEAIIGYDVRDQQAIDRAMIALDGTPNKGKLGANAILGVSIAVAR
AAADYLEVPLYSYLGGFNTKVLPTPMMNIINGGSHSDAPIAFQEFMILPVGAPTFKEALR
YGAEIFHALKKILKSRGLETAVGDEGGFAPRFEGTEDGVETIIAAIEAAGYVPGKDVFIG
FDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQIDYLEELVNKYPIITIEDGMDENDWD
GWKALTERLGKKVQLVGDDFFVTNTDYLARGIKEGAANSILIKVNQIGTLTETFEAIEMA
KEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGEV
AQYKGLQAFYNLKK
Download sequence
Identical sequences A0A0B7GJS1 A3CMA7 F0FE21 F0FSN0 F3SIF0 F3URI3 F3UYF8 F9E1B3
gi|125717729|ref|YP_001034862.1| 388919.SSA_0886 WP_002897814.1.14437 WP_002897814.1.19051 WP_002897814.1.24838 WP_002897814.1.28899 WP_002897814.1.35304 WP_002897814.1.46691 WP_002897814.1.50475 WP_002897814.1.53392 WP_002897814.1.55564 WP_002897814.1.66479 WP_002897814.1.70434 WP_002897814.1.70500 WP_002897814.1.84202 WP_002897814.1.85561 YP_001034862.1.98618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]