SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001034888.1.98618 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001034888.1.98618
Domain Number 1 Region: 214-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.49e-67
Family B3/B4 domain of PheRS, PheT 0.00000736
Further Details:      
 
Domain Number 2 Region: 472-694
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.83e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00012
Further Details:      
 
Domain Number 3 Region: 36-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.54e-43
Family Myf domain 0.0043
Further Details:      
 
Domain Number 4 Region: 704-801
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 9.15e-29
Family Anticodon-binding domain of PheRS 0.00087
Further Details:      
 
Domain Number 5 Region: 411-480
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.03e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_001034888.1.98618
Sequence length 801
Comment phenylalanyl-tRNA synthetase subunit beta [Streptococcus sanguinis SK36]; AA=GCF_000014205.1; RF=reference genome; TAX=388919; STAX=1305; NAME=Streptococcus sanguinis SK36; strain=SK36; AL=Complete Genome; RT=Major
Sequence
MLVSYKWLKELVDIDVASAELAEKMSTTGIEVEGVTSPAAGLSKIVVGEVVSCEDVPDTH
LHVCQVNVGEEENRQIVCGAPNVRAGIKVMVALPGARIADNYKIKKGKIRGLESLGMICS
LGELGISDSVVPKEFADGIQILPEEAVPGEEVFSYLDLDDEIIELSITPNRADALSMRGV
AHEVAAIYDKSVHFKDFSLVENQKQAAESLSVALETEKAPYYAARILENVTIAPSPQWLQ
NLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLNTFEGDHIVVREARAGEKLVTLDGEE
RELEVSDLVITVADKPVALAGVMGGAATEISNQSTRVVLEAAVFDGKSIRKTSSRLNLRS
ESSSRFEKGINVATVNEALDAAASMIADLAGATVQAGIVSAGSLDTSDVEVVSSLADVNR
VLGTDLLYTDIVDVFRRLGFGLSGNAEQFTVSVPRRRWDISIEADLYEEIARIYGYDKLP
ASLPKDDGTAGELTATQQLRRQVRTLAEGAGLTEIITYALTTPEKAVEFTFNPSNLTELM
WPMTVERSVLRQNMVSGILDSLAYNVARKNKNLALYEIGKVFEQTGNPKEDLPNEINSFA
FALTGLVNEKDFQTKPAAVDFFYAKGVVEALFDKLGLTAEYAASNQIKSLHPGRTALISI
NGQPVGFVGQVHPATAKAYDIPETYVAELNLSAIEEQLQPEQPFTEITKFPAVSRDVALL
LKAEITHQEVLDAILAAGVKRLTDIKLFDIFSGDKLGVGLKSMAYSLTFQNPESSLTDEE
VAKYMEKIEKSLTEKLGAEVR
Download sequence
Identical sequences A3CMD3
YP_001034888.1.98618 gi|125717755|ref|YP_001034888.1| 388919.SSA_0914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]