SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001312928.1.44884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001312928.1.44884
Domain Number 1 Region: 108-188
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 2.09e-16
Family ParB-like nuclease domain 0.0045
Further Details:      
 
Domain Number 2 Region: 180-243
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.000034
Family KorB DNA-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YP_001312928.1.44884
Sequence length 358
Comment parB-like partition protein (plasmid) [Sinorhizobium medicae WSM419]; AA=GCF_000017145.1; RF=reference genome; TAX=366394; STAX=110321; NAME=Sinorhizobium medicae WSM419; strain=WSM419; AL=Complete Genome; RT=Major
Sequence
MAGNNRKNELRALFSGSAPAANQQAPADAMQGELTPVNARPTAARDVPDPAKARAASGAV
KAMGLSLGSITREAEEARVLREALNQGERIVSLDPALVAASFIEDRLTNGEVDDPDFLAL
VESIRENGQQSPILVRPHPERQGHYQTAYGHRRLKAVRRLELQVKAIVRPLTDDELVLAQ
GKENAERRNLSFIERALFAAALAVRGFDRKVIGDALAVQKSELSRLLQVAEGVPHEIARA
IGPAPKVGRERWMAIGGLLIREEARARAKDEIASPRFRAAETDQRFQLVFNCVSERDKPE
PERPEDLLDAAGQPFARLRRDGKTPRIEFLPGTHPAFVQEAVAMLARWHAAFVEKQRN
Download sequence
Identical sequences A6UH65
366394.Smed_4190 gi|150376332|ref|YP_001312928.1| gi|150376332|ref|YP_001312928.1|NC_009620 YP_001312928.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]