SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001312947.1.44884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001312947.1.44884
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily Aromatic compound dioxygenase 6.41e-60
Family Aromatic compound dioxygenase 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YP_001312947.1.44884
Sequence length 204
Comment protocatechuate 3,4-dioxygenase subunit alpha (plasmid) [Sinorhizobium medicae WSM419]; AA=GCF_000017145.1; RF=reference genome; TAX=366394; STAX=110321; NAME=Sinorhizobium medicae WSM419; strain=WSM419; AL=Complete Genome; RT=Major
Sequence
MAQDLGYLKETASQTAGPYVHIGLTPNFCGIGGVYEADLGASMVNDRTLGQRITVTGRVI
DGAGMPLKDALLEIWQADAAGLYNSPSERRGAADPNFAGWGRSPTGADDGMFTFETVKPG
RVPFHDGRLMAPHISFWIVARGINIGLHTRMYFPDEAVANAADPLLARIEHRHRAETLVA
AGRTPNYVFDIHLQGEKETVFLDI
Download sequence
Identical sequences A6UH84
gi|150376351|ref|YP_001312947.1|NC_009620 WP_011969836.1.7720 YP_001312947.1.44884 gi|150376351|ref|YP_001312947.1| 366394.Smed_4209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]