SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YP_001313319.1.44884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YP_001313319.1.44884
Domain Number 1 Region: 27-166,201-243
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000167
Family NodB-like polysaccharide deacetylase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_001313319.1.44884
Sequence length 256
Comment polysaccharide deacetylase (plasmid) [Sinorhizobium medicae WSM419]; AA=GCF_000017145.1; RF=reference genome; TAX=366394; STAX=110321; NAME=Sinorhizobium medicae WSM419; strain=WSM419; AL=Complete Genome; RT=Major
Sequence
MKMGSAWQRCVDRLDALQDGGKCIDFWLRDDDAVEPSPALDRLLDLTGRFSVPVTLAVIP
ASTDERLSRSLSSRMHVDVAVHGWSHRNHAPAIEKRQELGAHRPRETVAADLRAGWARLS
ALYPAALAPLLVPPWNRIDPGLVSELQEIGFEALSVFGPEDGEKCAAFRDTGLQLINTHV
DVMDWHGTRGCRPHGDILRDIDRRLDEVENSGGSVGILTHHLVHDESVWEFLSKLFEITT
SNPACRWRRITELIDR
Download sequence
Identical sequences A6UIA6
366394.Smed_4586 WP_012061519.1.7720 YP_001313319.1.44884 gi|150376723|ref|YP_001313319.1| gi|150376723|ref|YP_001313319.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]